SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_05153T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_05153T0
Domain Number 1 Region: 486-644
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.37e-23
Family Growth factor receptor domain 0.00024
Further Details:      
 
Domain Number 2 Region: 890-1046
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.74e-20
Family Growth factor receptor domain 0.00041
Further Details:      
 
Domain Number 3 Region: 1036-1196
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.4e-19
Family Growth factor receptor domain 0.00016
Further Details:      
 
Domain Number 4 Region: 707-847
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.05e-18
Family Growth factor receptor domain 0.00042
Further Details:      
 
Domain Number 5 Region: 1562-1739
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.82e-17
Family Growth factor receptor domain 0.00027
Further Details:      
 
Domain Number 6 Region: 1242-1356
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000128
Family Growth factor receptor domain 0.00014
Further Details:      
 
Domain Number 7 Region: 1683-1855
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000131
Family Growth factor receptor domain 0.00062
Further Details:      
 
Domain Number 8 Region: 1304-1470
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000209
Family Growth factor receptor domain 0.00082
Further Details:      
 
Domain Number 9 Region: 388-436
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000012
Family Laminin-type module 0.0059
Further Details:      
 
Domain Number 10 Region: 100-169
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000149
Family Fucose binding lectin 0.073
Further Details:      
 
Domain Number 11 Region: 1475-1571
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000171
Family Growth factor receptor domain 0.002
Further Details:      
 
Domain Number 12 Region: 439-486
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000204
Family Laminin-type module 0.0065
Further Details:      
 
Domain Number 13 Region: 275-333
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000279
Family Laminin-type module 0.061
Further Details:      
 
Weak hits

Sequence:  PTSG_05153T0
Domain Number - Region: 331-380
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00558
Family Laminin-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_05153T0
Sequence length 2069
Comment | PTSG_05153 | Salpingoeca rosetta laminin alpha 5 chain (2070 aa)
Sequence
MPSAALNPSPTTTAALGRPIISTSTCGSPADTYCYSEASQCFTCNATCPFPSADALQSPI
EGLLPQPECGCPASYPVPVDLDSCCETAAAQSCVRRINTEAHPPQFAVDADEGTYFQSEQ
NAARVNVTLDLLLPYEVTTITVTFSERVPYAFAILKSNDAQTWEPFQFFTRDCEEFYGIA
PDQQLTEPDQVICDTTKTSVRNDEISLRTLTAARIQLAGGSYAASDVLHDFVHTRFIRVA
FAQYYDETTAVDDFGVPLDHEPFYTVTNIQVEGRCGCHGHAASCSVDVDSAACACEHNTG
GPACGECLPLFNAKPFARGISDDEPNVCVACDCNEHALSCHYNASLDAFPNDRTRGDGGA
GIHCETCAPGYYENPAVPRNHVNACIPCECNAAGSESSTCNPKTGACECKANVMGDLCDM
CKPSFYDLSLAHDEGCESCDCVVFGTIEGSRDCDATTGQCECLPSNTGQRCSECSVGHFH
LAGTEDGVCIGCHPQCSDTAGCNGPGASLAACNGQCRNVEEDGVCVDACSDGRYANEQGV
CRLCHPQCLDTCTAGTASTASCSQCRNFEENGLCVAECSANTYADDNLVCQQCHDECIGC
TGPTPAQCKQCRHVRSNGVCVAECPEGTYADGSGVCQPCSSECVAEFGCTGPDATQCFRC
DGVYDVSRDAVPYVCLSTCPPLYHATRMTLLTEQPNAEVVVVEDAAVCQPCSTQCEFGCD
GPTTSDCVGGCVAASYNGRCVPACPTHTYRDGELCIDCHPNCNHTQGCYGPGRDQCFDCR
QEGVSLNGDCLSACPTGYFADEDRVCQPCSPFCSTCFGSSAAECFRCKSHRLGVKCVGEC
PSATTYITAVPGGALTTTASPVTDFGSSGDASVAPPRPPRNHTTAPIAPYECFACHPQCG
LNGCAGPTAYDCDECESVKYDGECISTCPPLTYRDGNVCKDCSEECADGCFSSGADSCFA
CRGFEVEGVCVGACPETYVMMNDTCLPCHRFCSLDEPGCSGVGPDACNACAPTRFLHVAT
QTCVAACPSNTFATRDRECLPCDEECSGGCLDAGADNCRECLNVKLADTCVAECPDGFYA
DVDGECQRCDPMCASLCTGPGPSRCARGANDTSACKHFTRGATCVAACDALTEYADDANV
CQKCSPLCADGCVGPTAADCGACASAELDGTCVDTCPLTHYRDEAGLCRRCNAECASVNG
TRACTGPGADACLACAHVKRGRECVRSCLTREVAVDGVCRGCHAQCSSDGCFGLEATECL
TCRNFEFGGECVAACDADTTYTSTATAECLPCHRECSLRAGSGGCPAGTSADDCVVCAHV
RDNGRCEAECSTGTYADEADTETALGGVCKACHPSCDPLRGCTGGRADECNECAHVSYQG
VCRTACPDLTYLGSGSECLDCDANCLLGCTGPGADQCVRSSNVLDSSAEALGCRTFVDIL
ANGVVMCVAECPITKYADSNGVCRACSTLCPLEYGCTGPTLADCNSCPATQYLAPDRTCA
DCSASCSTDLDLAGCTGPEPKQCNVCAGARYSGGCVDDCSALTDVDVGLYFGVDDTSVPD
EVQCVPCHEQCVAGGCTGAGPDQCLFGCKNFAQVDGATGDVTCVETCGANTFVADTPVPR
TCVPCHSRCRGGCRDETPFTCVECARFRTEEGECVDVCPPGWVPGTDGVCRCPTDRSYTN
TTSGQCLPCSVLCSAGCTGPLPSQCKGGSDGCTFAEHNGVCVADCPTGMVRQNSVCVCKF
NHITVTDPADGCMPCDDQCADGCTGPTASDCLRCRNYRSGEVCVEECAADEQPDADRFCA
PCHPECAGGCIAPGDALQCVSCRAYKDAGECVSNCPSERFFVTQSGVCVEECPSDTPFYN
DTRPLGEADPAAPQLCVDACAALGALRNLVNKDVPQRCSTQAQLDVDFASASGSSATKLT
QTSLTVIVAAGVLVLVIVVAVVLVLRRRRRESSAAFATPGGKVTALNPGAKVSPTRTKLN
ALYEPSPRRPGHHSGGGGGGDVSFDGGPRYDVANISGTDSSMYMDPMSLNDTADHMDGYL
EVRPQNPYSMSDQALFEPPINSAVQSTRM
Download sequence
Identical sequences PTSG_05153T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]