SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_05162T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_05162T0
Domain Number 1 Region: 80-258
Classification Level Classification E-value
Superfamily C-type lectin-like 4.2e-22
Family C-type lectin domain 0.0017
Further Details:      
 
Domain Number 2 Region: 342-505
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.86e-18
Family Growth factor receptor domain 0.0014
Further Details:      
 
Domain Number 3 Region: 1153-1240,1346-1398
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000816
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 4 Region: 862-903
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000824
Family TNF receptor-like 0.0035
Further Details:      
 
Domain Number 5 Region: 969-1159
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000022
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 6 Region: 765-817
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000392
Family TNF receptor-like 0.0054
Further Details:      
 
Weak hits

Sequence:  PTSG_05162T0
Domain Number - Region: 647-691
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000471
Family TNF receptor-like 0.0039
Further Details:      
 
Domain Number - Region: 905-944
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00118
Family TNF receptor-like 0.005
Further Details:      
 
Domain Number - Region: 554-596
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0137
Family TNF receptor-like 0.0047
Further Details:      
 
Domain Number - Region: 820-853
Classification Level Classification E-value
Superfamily TNF receptor-like 0.037
Family TNF receptor-like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_05162T0
Sequence length 1560
Comment | PTSG_05162 | Salpingoeca rosetta conserved hypothetical protein (1561 aa)
Sequence
MYTCKACTRVYTMPTSNSHSVSQYHRHRHMRETGSHAHQSSDGDGNKWCYVDATCPSATV
DSDFPALHRAPCGLFPDCTDFYLTRICAVEQPACEHGFTRINNRCYKVATTASTAGNSPI
TTSFAGAVDACSVDNATVVSLHSLPETENVVQLLRDAGVTSAWIGLRTTENGDVAGGVDY
MWVDGTPFGDVNSLGTFANWADGQPTAQGGKDGCAYLDLTKDAATASNSTGDDKRAAGLW
YDDGVCTAQRAVVCKKLSPIVTPSCACTGQTNSDGDGGACGTWCYVSQYCPRAVEDQDNE
GLFWAICPRHFQTSTTSTMPASSTAPPESTTGGTTTTAAPTCHEMDPSTYTRDDGTCAQC
TTTDDCDTNQVLLGECGMFTTPVCVACDSTCAACSALGADKCTSCADGYVWSLDGKRCVS
SCPLGQFADTSAGQCKMCHDTCATCDGTADNACLSCAPASNLFLQPNDNSGGGGGDMSRA
RGVCVAECNRGFFANQESQRCVACASCNKDTDGNALYEVTPCTATADAVCARVTACAEDE
YETAAPTPTSNRVCRMLTPCKAGEYELKAPTTTTDRKCTQCAAGTTDLDPNSINACTTCD
AGTYTPPGHVGPCPKCPAGTADDDSDPSTPCAACMLGQTYAAAEGSLSCSRVDMCAPGEE
EALRPTTTRNRVCVACTMGTFNAIGGNGTRCVPWTTCGAGMQPSNDAPPSASQDRTVCDD
IHDCPSGSYQVHPPTPVSDRVCAGLTTCGEYEVVAMEPTPTSDRVCESCDGTSEYFKEGE
CVAVTECPPGMITLADPTPSTDRTCTRCPNKHFKATAGQEECQPWTDCVVGEVVTTAPTA
TSDRVCQLCDPTYNQYSSNPTATQCENATVCEPGTYVDVPLTSTRDRKCKPCPSGTFSNE
ANMASCTPVQPCSVGSGLVTAATPSTDRVCAPCSPPHTFSSTPTLEACAPVSDCAPGYEE
DTPPTLTTDRTCTPCEATVTFKAESGQAACQSVSACPAGQEEDIPPTTSSDRVCKPCGDG
TFKAGEAGMCQPHRGVCQPGTHEVTSPTTSTDRSCESCLVENSEYQDEQDKSTCKVLTTC
RPGSYVSVMPLPAQNRECTACPAGSYSDTENAAQCTPCGEGEYQDARSSVKCQPARVCGV
GEFVSAPATSSSDTQCGRCDGTTEFQNEPDQTSCKPVRVCGSLEEQVVPPTAVSDRVCQC
KLGVGYVDNGATACTPVSVCQSGHVEFLPATRTSDRVCVMRGSAGSLQVQFRADFSILQN
AEEEATFLQLLFSALRNTTLSARGGVPAGSDDVYFKGVLSAGSILADVGVSNGSLVPMLQ
GAVESGHVAFWWRAKQQRFVAVLAGPCPPGYISPSGSRPNCTACPANTHANDAATVCTPC
PDGWTSPEGSADTNNCQPPVTVSPTPTTTPQGGTRSPEKSSNTAAGNTGLIVGIVALILR
RRRAHVLQPPRKSRDGQQSAFHNPPYEDPTSLTRGGDADTGYDNVPGYGEGDGGYDHVPG
IGPALSNPTYDTALFASADPPYDTLDAALDEDDNMQHVHGYLDVVGLQDQCALHSRLDRR
Download sequence
Identical sequences PTSG_05162T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]