SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_05179T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PTSG_05179T0
Domain Number - Region: 80-146
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.000527
Family Type II chitinase 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_05179T0
Sequence length 162
Comment | PTSG_05179 | Salpingoeca rosetta predicted protein (163 aa)
Sequence
MRTNSSQLAHHPAGPQLPPHHLAMNSVGVTSVVLLLAVGLCLAGTQGLAGAKQVPKTLFG
GWLFLDNEDAPFNGTLAGFLPPNTNYIILSFVDPRTMVLPENMIQTIKSFPNHLVMVSLG
GQTMAGNWDWLASEEQARAAARTAASWAQEALRYGTLHSDEL
Download sequence
Identical sequences PTSG_05179T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]