SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_05252T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_05252T0
Domain Number 1 Region: 41-79
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000265
Family EGF-type module 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_05252T0
Sequence length 2101
Comment | PTSG_05252 | Salpingoeca rosetta hypothetical protein (2102 aa)
Sequence
MCPGDECKYKECNAGYEMTVFGSTMRKCDWIGSDVGWTNTAKECIDIDECLTGEEDCYPG
SVCVNTEGSYYCVCEFGEQQESSCFVEVPTITLDLGLTEMTINIDGEWGNTFPKYRVSVA
RWSYDLAAKEDIPGFPKTIRKPFTSHRVINLEAGTRFRVTLTPVGNNDEEIPYFLQLALT
PEGNDPQTICGCIPADPTGAPTDFQIRQFKGHVLFRWADQSQCESAFSFTRNGVGLTSRF
PVTEQLACGAIQEPNTVYDDLTIQSAGDYAEVDEALNYLLPEGDFYLRHFLAVDTGDTRF
MYPHELQRQKTHFSSTSTTTTAAPQGVPDDENRYYPGTSSPVASVSECKDLCDIRSDWCI
AFAVQTKGDDTLMCHQLRVIQNATLRAGEKKAVSFERVTVTGTGVDGSYIFDGTQDDCEE
ACSAHGSCDMTMVAAGVCAVVVDAVETETPLAQSVHPDIDPTFSRRIPGPEPGTTQEYCI
EANKPEWYDLQGYSSEPTCSNFTIMWESQLEGQIAIDSKEIHLPVEGVEVEFEIGGLVRG
RRITNEDGKFSIHILSDKLVGSRHRMTLRFSKTTGNIKHTFTCGGIACTETTLIMEHLRF
DHTVNVRDSTSLPFSGIVSIGGTEHEGLPDGCPLKDVEVCLYDRNQANTLVNCDLTDSKG
RYLVRAVLGTSVTVGLTFANSSHTFERAPYKRDAANAPSGILQRVDATNTLVRTLYYDVT
DGKFWENINFKDTTSDRATVDIAGGLCNLNLGDAVMEFRYDACPTWVRTHTISDRLSKWT
LPAQIITVRFKEITRNYEVRGEITRYFSAKLGNSRSLYLDLRNPQEDDEDKKTVRFEYRP
PPQLSVSFDKEEKHNCNSTEGDRPLHVVRQNQELKVTVKVIEDYGEGVGTCDAVPGQIEV
ENQLGESPAIVDVLNATTSLTNKQLNKLKQCYDTCLMDVKMDEELQDGETVYSNTRIELN
IMTGEPETNPQAVNPENPYSKLFRVTMHNLPQDPVTVYEKVVVIGDKVISKYFSVPFPRY
QPLAVVQDPPGGLSTVTYSKAYSNYFMKSHTHEEYHGFYFTTGLAPVKVETGVQQCTGLG
AAVCTKVADTESTPFKISVDQTHTFGSMDPDDNYNSERVWSFGIELTTSDDVMTAGEKSD
MFLVPALNVVWLETEEVSFDVEQCQAAKETKVKWSLEGQENREVLSWVSAFEIENKELPD
LRKLLALAEQPPGDDDDDTEEDRAEKIAELKRAIKAWESNLDRNKEVRQKAADGLLEPVQ
NMWAKGNAEFDCLPSIAPNKDPKKAAKIEGELSRTKVCNGFDVDRIADKAKKGISLAPHD
DIDNAKDLDGLAASDQDKQDLRNIDTIKFSGGGSTYTFEYDLSRGDSVIGGSSRTHEVSA
GIDVEFGFKVFGVGMSFELSTGYNYEGTVADEYEAGVSTEGTLSVTLGDPDPFDVFDVGV
FLHPDYGTFVFATFSGQSSCPHEPNTVQLEKPSVSVLKRPEAPVLPGEPAVFELLLKNDG
PVTSDFNLFYLSWLNQDGLEVVANGQALETALIFEGFPANSARYITITVNQGPSKFKYDP
VAIGWRSLCEADRHPDNGYITDEVTSVEYVYLEAEFLQPCSPVKLVGEIGESGAFTLNQE
TMEQDYKPGQIRVVAFNPDHAERTWLEDDRLEKVVIEFKPVNSYVWLLARDENGDALDIR
ERENEYGYITSWWDASTLLEGDYHLRIRAQCQASINEVPDGIDEKLSLVAAGVVDRDPPV
VFGFPEPADGEFFPGDEISFQFNEDVECRQPFIFQVSLTVEDYDRDFNNNNMVIVCEGRK
ISMSLRRGFRYDEVNGLTATVVIENVKDLNGNQMEFPPEHTFTFAELNLADASVTLSGLV
VNVPYQDVYADTTSQEYADFAGVLQTELATVVDTDPSRVTITGISPVDATNYNSGITVSL
RFTPEGTDTAATGRRRRATTSTATDLASLLQSRLQNATYTESLSVLNSASLDEAAIVDVE
PSATDTAQQQTSSSNTGGASASTSLSSGTSTSSSDSWAGIKLDASLALNIAQLLIVIAVF
ARMYGCAGKNKGAEHDDADASGEKKATGDSQSEQSTKWFKPWSRSMSAKVKPFTAEPENA
V
Download sequence
Identical sequences PTSG_05252T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]