SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_05279T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_05279T0
Domain Number 1 Region: 35-154,211-397
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.27e-49
Family Family 1 of glycosyl hydrolase 0.047
Further Details:      
 
Weak hits

Sequence:  PTSG_05279T0
Domain Number - Region: 431-507
Classification Level Classification E-value
Superfamily Cupredoxins 0.0264
Family Multidomain cupredoxins 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_05279T0
Sequence length 516
Comment | PTSG_05279 | Salpingoeca rosetta hypothetical protein (517 aa)
Sequence
MRGGGVGVVAAAAVLVVAVGICVVDPQHVAAQPLVVNTTTSRLVDSHGRERIFHGTNVVF
KGPPYVPIIDRFDYQYSFSKDDVALLSKWGVNAIRLGVMWPGVEPEKGKYNQTYLQHLQN
ITAMCEEQGIWVLLDMHQDVWSERFCGEGVPYWAADPGPDAKGFPAPLDKPYNVNSTTGL
PSAQDCGKHDWPDYYFASAVGAAVQRMYDNQDGLLDAFCSFWALVASTFKSYTNILGYEL
INEPWAGDVNKDPDLLVPGQADKKNLQNTYDKAAAAIRAVDPDTPIFFETVTWDDVVVGF
SHPPGGADSGHKSVLAYHRPSLSCRRLQYYMPPNFGPKETIQLHLDAAKKLNCGTFCSET
DGEVFFETADPFFQSWMRWEYKAFVPKTGSNFGFWNSNGTVNSDMVFNLTRTYAPIIAGH
GVDMHFSRENSTFELAFLLNKTCTAPTVVYAYTALHYPNGVNITVDPPVLSWAETTTNYY
EFKPILRVAKDGQRVTVTFKNGESHANAVHSDGLGG
Download sequence
Identical sequences PTSG_05279T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]