SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_05294T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PTSG_05294T0
Domain Number - Region: 110-154
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000419
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_05294T0
Sequence length 1197
Comment | PTSG_05294 | Salpingoeca rosetta hypothetical protein (1198 aa)
Sequence
MAVRVGSVTPPAHKHARQHHQQTSQTNHRFHNHQHSKRRRRRQQSPWRATASVAFAVVLL
LVCQSCCVTGGLRLVMLSPDDEDGGGAADKRGIINDSTNVNPNDAREQACDLQCRNGGKC
VVDASTVGGGTRIEPKQTCQCLEGYHGSRCELFNVLQEDFHVGPQGYLNGLYQECVSGWS
VSIIRSMGGFSLPTIGATGRASSYRPDATFLQVSGVYEAAWVSPHLDMTYLHDAKVSVDV
EANSFFITHRSRVAIKYASDVLPSSAPLDAWLTAQTSVSSQPTADGLFRVDATIPATATH
VAVVISLQDQASFMRVRTVTVSGERKDSMVWLETFEGLEGVGVSGTTYMFPPSWYNGPHL
RWFIAPESKPYTALPLSYMLVRQTHARSTNADVTAQIPLAMETAALPTAMSWTTDKIDIS
AYSSARVSLWAESDRFSIEATDFISVAVWTPESNQWQPIAHITGTNSDYNEYSCLNYCKG
TCLCNRLTITSPPISGSSLRIQVIVSAGDIDDVIRFGQVMVSAVPADHPRPPPQSTSSSS
SPASSSSPASSSSSSSSSSSSSASQQSTVSTTSTSPAAASSPTDGGKHPSTTVTSTNANK
QSSSSASVIISSTATQVMGSTTTTPHAIVHSSSSLASTTPTAGPSPTTAATMKVTATTAT
AATTMTPPTIPTTTTATTTTPVDAAFTPVVVVFPGGRAMLEAATGAHIANTAFVDPTSED
AGSGGEPRHGGALAMFAAAVEVHLEAAGFSIPSDLHVHRVDGDEALTTTIWCSANSSSAS
HGGGSSSSFSSSTNGNVSGDSSRPVAERVQALRDKGQLRVVVYGMDFVGEAPPPSPPPPL
STKSASVASSGSTTTTGVPTTGTHMPHTTTAHTSTDTAPAASTVSTTTHRHATNGGGGGS
QPTGSGSSSTSSHPPPGVGDTHTTATQVSSHPSRDTTPSSGLPPGVIAAAAMVVIFVLGL
AGLFMYDKFLKRARMRMVVHLIDDQHNNVFIGDNNNNNNDNNDDNGAAGLPAIPEEEVRA
FDHPDFDEDIDGGDDDDYVHDHHYHHEVDAADDDVVVDAGVGDSAKASDGGAADNGARGS
DGRNKAQHVVVPVSTSELSLHTSHDDDDDEDDEGARGSDHGRCASDHAKGACVDFTGVYD
EVEYTYPSDAHTSRVRRYTHDTTTATPTPTPTPTAATGHPRSVRSLRTGAGANSSHA
Download sequence
Identical sequences F2UA09
PTSG_05294T0 XP_004993866.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]