SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_05334T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_05334T0
Domain Number 1 Region: 222-290
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000334
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 2 Region: 324-390
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000403
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 3 Region: 528-587
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000403
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 4 Region: 381-439
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000334
Family Complement control module/SCR domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_05334T0
Sequence length 2118
Comment | PTSG_05334 | Salpingoeca rosetta conserved hypothetical protein (2119 aa)
Sequence
MAVMNTDAAVISVLKIATTTVTRIATPDVPKAATTVGASTDAIHPATHSVPGQTVMVDAL
PTATQIVMTPATAHVTREGCDQCDESCDDCTYGSCDSSCDGSCSCNPGYYGSGTSCTACG
PNTYSASSGQSSCTPCGSCGSNQYRVNCGGSNAGSCTSCGSCPAGSERTGCSGTSAGTCS
PCDSGTYKTSQDNQPCSPCGSCAAGYYLAGCGGSSAGECVGVQCNTPPSVSHGSVSSLSN
NGRYPSTATYTCAPGYMLASSSDNKLQCQTDKTWAGTMPRCIGVPCPGISIAHGSVSPDT
GDAQRSCIASSGGFGGTAPSCVGVLCNPLSDPQNGHLRLSSTPARYPATAEFSCVPGYEL
VGQAQLSCKTDKTWSAPAPTCRGVLCTAPSIDHAQVSATSGRYPADASVTCAPGYGLVGA
PTLSCRTDGTWGELPSCQLCPANSYAPSPTQPCASCPSGTSTNGQTGATKCECIAGHEPS
GDGSTCVPCQANHFKPDFGSVSCQPCQSGQSGFQTENGDFTRCVGVPCGPVQDIENSDPE
NTMMHRYPATVSYECDTGFQLVGDVSSITCQTDGTWSALPSCTYICGDGLVVDGEECDDG
NTDDGDGCSSTCQLEDTHACVDPGEACVYCNFTSRPERLVLACDDPMLDTKVQTWADATG
NAEVLDHEHCGDPSLSYVAGKPRGTVPGCYRSVYEFMVAFNGGKVMETATGVVRVYDDTK
PTFQDPPSSTTADCHSVPAFADVSASDTCMASSPAVSKQEVRTDGACPYAYTLTRTWNTQ
DACGNENAATQVVTVQDVTKPTFTTRPTDRVLECSADVDADIEALRMKHVDAAATDLCSD
TLLFETVETARDLSGCGGTGQVSLKVTVTDECGNPQEETVTVDVVDKTAPVPVNVPADVT
VECSAIPPIADDVHARDACGSRRVNATASEERQDGPCPHSYDLLRTFTFVDACDNPVSRT
QRVTVQDTTGPVITRDADDLELECSAERNDATIAAWLAVNGGAQAMDACSGVHTLTWTHD
YDPQYYEVFPGGCSVGTGQVLVTFTVADECGRTSTVNGSIKIVDTREPAFVAPLPPLTGA
CDAVPQATVPQAYDNCTGEVTPTQTTTRMDGDCPHQYHLIHSWVAEDECGWTTTTQQTVT
VTDAAAPTITKQSADRTVECSVADNEARLDAFLAEHGGAQATEVCGGVTWLYSDVDTVLD
LAQGASGDVVAQDGCGTTFTATAHFYAVDECSNAARTTATFTVQDTLAPVLDTPPAASID
ASCDAVPALSNISATDMCAGALVAVASEERLDGRCTHTYTLSRTWMVQDPCGHMTTKSQL
VHVDDSAEPVITKEAEDLVVECNAETDSVIAAWLEAHGNAAAADACDRELTWQHDFESVK
YLLQYGCGSNAVNVTFTVMDDCGNAAETQARVVVQDTTAPFFTQLPSDDRAECDPTTNQN
TLDAFLATYGGARASDVCGSVVGQDVAWSYVVDLQTVGNVTVFYRVEDACGYVGLANRTV
HVRDTLPPEVEVLGPGEMFVRAGSTFYDPGVRARDNVWPTVSVETVVVADGAESRAVHEA
PQAQGREVFHVVYTVRDGSDNQVTQVGRTVHVLAAPERSPASSSATLSFDFGVTLAVADV
PGGGASGAGGRREVYSVARAVTSVSVDPAAHTLEADGLDVVLGGDVEDFVVEGGDGSSAS
PGAAYVELHVVVGGATADVVEAARASPKVEAMTELTRAVSFFGSMRNADGDCAGLDTIPD
ALARHGRTYVSAECEGCLCVYEALEPSSEGEFDAPQLEETVQYHVTLRPSDNRAFNLAQL
RLKLYELGVVPVLLRFEPTPAPTTTTTTSTTSATTTDTTTSAAPTSAAGAGAGTAAANAT
AVSGNATATVTATGGAGTSSSTTTASTTTTTTSTTTTTTQAVEAVTFVTRTPLPKGSDAL
LPARAVVENVRAVVATRVEMAVTPDLTRVTLLNQLYHLGIVPKTWSMEARESETVLVVVT
YNDVTAAAVATLENEVTWVLGAVSVTYLSTEPLTPPAWSCNYTVDTAGVGANMTGAAAAV
NETLHMQGLTQGVDYRLHGCDGDVNASAACVIETRAALGGGVLLALEAWPAVVAVRDDGC
VTLDDLLLTSIKAKLGRV
Download sequence
Identical sequences PTSG_05334T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]