SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_05424T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_05424T0
Domain Number 1 Region: 60-219
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000329
Family Laminin G-like module 0.052
Further Details:      
 
Weak hits

Sequence:  PTSG_05424T0
Domain Number - Region: 991-1032
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000157
Family TNF receptor-like 0.0079
Further Details:      
 
Domain Number - Region: 954-991
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000306
Family TNF receptor-like 0.005
Further Details:      
 
Domain Number - Region: 410-539
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000487
Family Growth factor receptor domain 0.0095
Further Details:      
 
Domain Number - Region: 804-848
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00141
Family TNF receptor-like 0.005
Further Details:      
 
Domain Number - Region: 911-950
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00549
Family TNF receptor-like 0.01
Further Details:      
 
Domain Number - Region: 581-638
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00576
Family TNF receptor-like 0.011
Further Details:      
 
Domain Number - Region: 1041-1099
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0232
Family TNF receptor-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_05424T0
Sequence length 1886
Comment | PTSG_05424 | Salpingoeca rosetta conserved hypothetical protein (1887 aa)
Sequence
MSSTSTTTTTTTTTTTATTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTEQPYVDVLEGVS
YSFPGTAGLRVSSNVQLDAVGDSFSIATVVRQSPGTSGYIFAKASLQDGRYFALLSSGGS
LVLVYRTRGSTTTSIARIDFDIADGDLHPLLVVVDGTTLSITLDASWPGATTLSTALAGL
VDDCGPLTEDCVLLVGQRETGGGLYTGDVLGLWLYDNVAVTTFPQALLDATQNATLVAVT
PSTTTTTLAPTTTTTTTTTTTTTTTTTTTTTTTTTTTTGTTTTTTAGPCPTGQYQSSPGV
CEDVRVCTFECFGPSCPQFSECPQNCHSCRINSNQAFCTLCSNSQYLFNGACYANCSSFD
QASPQGQNELGRTCVLAPDSTEQVETPPELEYEVAPPTATTDRRCAVSEPCPTGSYQTVP
PTATSARVCVDCPSGFSDHDSNPLTACERCRAGQYTAPRSTGLCLTHTCDEGTIDDDSDA
STPCVACDPGTFVPAGKSGACSAYQCQAGTSDTDSDPATACEACGSGTYTPAGSSGACMD
HLCAPGTADTDRTSATACAACDGDAFQPLQGQTFCFPVSDPCDAGFAETQSPTPTSDRGC
EACTEGTFKANAGPGDCSPVSECPEGTAEVAPPTPTSDRQCLTTTTTTTTTTTTQLTCST
GFYIAADCALFDERPATCWAYEHCAYNEDTEDEFEVAPETATSNRVCAAATPPCDSATHY
ETAPLTATTDRECTLLTVCNPLWEYQTVAPTLTSNRACANLTVCNATQYASVLPTYTSNR
MCSALRTCEVGQYISVRATPTSDRSCADIDECVAGQYETAPPTMFSNRECTPCQAGTYDD
DEDPTTPCLDCPKGTFQNEEGQTSCIDGSFVCPRGTREVQAPEGPNPRVCEPCDGVTEYQ
DLADQTFCKAVTPCAPGTYEVEPASSTQNTQCAACDGVSEYQDEEGANSCKPITGMCEPG
MYAIIPPTPSTNRACASCDEGATFTSTSNALQCQPVNVCQPGTFEAVAPTLSSNRVCVPC
QLNLTYSSTTNAPACRSVRQFCGADQYEVAPPTLTSNRLCDDLVQCAAGTHRVSETECAD
CLLCGEEEYETSPCTPTTDRTCDVCDTCGFNQYIIATCGVTTNTDCGDISPPCGDYQYES
AAPTATSDRKCSAITQCDPQQRQVIERPPTATRDAKCRTCDAGTHPIGNLTCVACSACNT
DQYLIAACDVEDTMCGDCDECAAGQYAKVPCNATSNTVCDACDTCASSQFETVACTTTTN
RKCQDLRVCEDDQYEAVAPTATSNRVCLDITPCLASNRQITVTPATPYSNAVCRTCEAET
YPFNSFACLTCLTCGADEFETSPCDATNRVCQTCASCGPRQFMAADCTATSDRMCVDARE
CNTTTHYEAARPLDADVVCEPLTACNASAYEWIAPTPTSDRECALVTVCSDDELETAAPT
PTSDRVCERPACADDEYEVSRATPATLECAPLTACNASEYERVAATATTDRVCAALTVCE
DNEMVITNATATSDRVCAGGPVSAASDTLAGGSLAGVVVGCIAFFILLVLVLLALASGKS
RVHKYKVETSLPAELERDNDFWKREEFSVEVAPPIKQIPRGTHRHRQQQQQQQQQQPYVR
SRHNNYMDLDAPSAITPAMSMIGDAESHVSGPAHYDVNHHHTQYQQQQQRGIGAGAGGSD
GDGSGGMSPASGRGGSSMLSQQGSELTLPAEPDVLLVNRRSLDGRQWLSPRGLTAQQMAA
HQYNQQQQLLRQQQQQQQQQQQMMMMSPLQSAGPSSSEMPPRIATTQGTPSGQVPLYGTL
SSLPQPADKPGPQLEYRRMSELFYPNGSDEGPSMQMRAMPASIPEVNEQAGGDGDNESDN
ARTDPPSFSATPLLPHLLEVEEDTSL
Download sequence
Identical sequences PTSG_05424T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]