SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_05454T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_05454T0
Domain Number 1 Region: 85-221
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.34e-26
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.025
Further Details:      
 
Domain Number 2 Region: 224-402
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.9e-23
Family beta-glycanases 0.0078
Further Details:      
 
Weak hits

Sequence:  PTSG_05454T0
Domain Number - Region: 639-679
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.00706
Family Invasin/intimin cell-adhesion fragments 0.01
Further Details:      
 
Domain Number - Region: 27-66
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0247
Family Pan module (APPLE domain) 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_05454T0
Sequence length 793
Comment | PTSG_05454 | Salpingoeca rosetta predicted protein (794 aa)
Sequence
MGPPGCMFRNISGPLTCSGFNNNPNRFSARDCELACCYNPECRLWFQHNKYCFHGGEGAS
CKPAGENATVYSAGERDTSPPLVKPYNFTSKSFDDSSWPIVDAPHDFVISNSHFSPQANS
FHGHLVRNVSWYRKHFHVPQEWQGSTIYLYFEGVFHYTQVWLNGMYVQSHACGYTGFTVR
LDNSSTLHYGSSNKNVIALRVDASFGSGARPSSARVMTRNNHDSTDTSGCTPEYVSDMHD
MVKRDRNHPSIVIWSFCNEYECQQQTNITSVLFRAAAKALDPTRAVGANGPTGSLDVQGF
SHRKASVFEHFHKNNPNTPSVLSECCSCTSQRVGSARHIPECICDQNSPGLLPFVAGSLG
VWTLLDYYGEPPSSWPAVSSAFGQFDLAGFPKPHAWWYRINWLALVDSSDPARPALPPLA
VSRVITLLDSLVPSSASSASSKQAEAQQQQDREDQDQAPRLLPAAGTSGHRVNVSTISSS
NTTELLVDGVSVAGNRSADRGVEVIWSVPVPANVTCPCNLPITADVQCRGLSKMNNASTP
QECRRACCDRPTCTVWQFADGPGCWLGQYNPATCFPGHAANWTGQASAGPRCSLFTNVTV
IGRAADGTEESRHTAHGPAGPAALQLMVDAPSPATGTGTALALDGRDAALVRVTVVDANG
NLVSTPAVNVTFHVTQGPGRIAGTGNGDPRCLMPPHAPVMTTFGGVARAVVHVTQDCLSA
ARETIRFVDVDGGHRTQLPANCTQQDIVVTATAANLTSAQVSIAAAPDATLLPLTVAQKS
FDMDYQYMDQFNG
Download sequence
Identical sequences PTSG_05454T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]