SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_05455T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_05455T0
Domain Number 1 Region: 163-268
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000145
Family Proprotein convertase P-domain 0.017
Further Details:      
 
Weak hits

Sequence:  PTSG_05455T0
Domain Number - Region: 88-170
Classification Level Classification E-value
Superfamily GckA/TtuD-like 0.0458
Family GckA/TtuD-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_05455T0
Sequence length 269
Comment | PTSG_05455 | Salpingoeca rosetta predicted protein (270 aa)
Sequence
MTCDGPALTQRTQQELNVLGQQWKTALLDACAIDTLRCRYTGGEAGSFRALAPSVAAVAT
LGAEEDLHRVQTCVETNGPVLIGDCTVWQVTASGIWASSMATMAMASTSTASTSTSTSPL
TSTDSTWLPSTPSELECRPPPLPLPDRVHACATAEVIDVVEDFVADEHLASLCVRMRHTY
AGDLLMSVVCPSGQRVLLTYQAGGDAGVDGTYCWTPTGTAHFPSPLPMQPDEPLSALDGC
STRGTWSLDIWDLFPGDDGHLHDFTVTLI
Download sequence
Identical sequences PTSG_05455T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]