SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_05572T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_05572T0
Domain Number 1 Region: 89-130,162-285
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000267
Family Growth factor receptor domain 0.013
Further Details:      
 
Weak hits

Sequence:  PTSG_05572T0
Domain Number - Region: 18-60
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0135
Family TNF receptor-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_05572T0
Sequence length 932
Comment | PTSG_05572 | Salpingoeca rosetta predicted protein (933 aa)
Sequence
MQTTCKTCMNAYQPNSGQAGCIEFASCGRGKKFVTGTTTTPSTCANCDAGTYQDQSGHFD
PDCKPCTGNTFTDQPGQQGCSAWSSCNQGQKWAAGSADADATCSSCTPGTYQNEFSHQHT
SCKGCGAGTFQSGHGASGCDDWKTCGKGKKWATGTSTTDATCSPCGSFHYQSKSSHKDTS
CTSWSTCGPGYEVTVEPTASNDRLCAMCDYGHYQDGTNQQDCKPCDPGQHQDERGQIECK
ACGAGKYQKSSGQKDCIAYSTCDRGERWVSGTKTKDSSCRSCDIGKYQNFLNHQRTSCKT
CPDGKYQLNTGRGSCPDCTTCEDGFEEVLPCTPTSDRTCEDNDPPTIVLRRPDNNAVITN
TYTVEAGLPFDPPIFTATDTAAGTVTKTPPPNLGDIDTSTVRSDQMLTYKATDANMNTAT
RTITVVVVDTTGPAITFDPAVLQLEAGEEVMRSNFTVGVSIVDRVDGTLGIDLLEYDASD
VNVNTLGMYEVVYTLSAPDSNDNEAPPTTRTAAVVDTLPPVITIGFGDRNVSEHNVVIHE
AATEFILPSQSAFDTFDTAVNGGDVRRNEEPTFNSVVDDDTQFTFTYTATDASDNTAMVV
YVIEVRDTMAPTITISGEHNITHEAGTEYVDAGATATDLLEDAIGRGVEVVVANNVLSKP
PSVPAVFTVEYDACDKAGNCDAINRTVHVLDRTAPSIELIGDALLVVEAGSNFSDIDPGV
TLADLYYDNADLTLVIDDGGYEAAPTATPVSFNVTYTVTDPSRNTASVTRTITIIDTTPP
DLRVNGNLSVTVGDGVTWVEPGIARAYDIVDRDVRSRVVATTQLEEAGVVVPTMCAYSSA
RAFVPPLSPRVWSSPRMDAVESRAPSGTVYRINYTVADAASNVAFVERVVRVADPTPPSL
QLLGDRVQALEYGPDAAFVEADGGAPTPTTAT
Download sequence
Identical sequences PTSG_05572T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]