SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_05617T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_05617T0
Domain Number 1 Region: 712-856
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000251
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 2 Region: 890-930
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000479
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 3 Region: 845-880
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000304
Family EGF-type module 0.029
Further Details:      
 
Weak hits

Sequence:  PTSG_05617T0
Domain Number - Region: 621-768
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0298
Family Growth factor receptor domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_05617T0
Sequence length 1230
Comment | PTSG_05617 | Salpingoeca rosetta fibrillin 1 (1231 aa)
Sequence
MNKQSKHGRRSRRNNVGVCVAWFVMVAVLALDGYDSVLNGVAALTTQEKLNQLCYQVSWD
LAAPRPKRQAIRPVSKFPHGHAYVNEEYCGEQKSPGCDVIPAYGNWLYGSTCQNVTGGSV
FYAYNYPNGASSNTGFEQSESDLLYFVVDEDLRVSFVLVHDKPDDPTGGRVRLEINSPDL
AGEGVQVLERDDNTGFSPSCFDATNDCYHWDTDTGYGNFYWAWAACCTDGMVLGHINDLE
WRFNIRYFKEDLVDIDKFKIGNFREDANTMDFITLDADAVSTSGVEVRALSCEAYCAAKT
SCGECIADPQCGWCESSGCTTTTLAETCAASEWQESGCCAVCTLQNDCTSCVNTPGCGWS
YDRAECLSGAYTQGSCEPTTWYQLHEANVTQCLHPPGAVFNDTSDSVDTDVVFDWCSGHG
TYSFDDNTCTCDAGYFGADCARECPGGASNPCNGNGECDALTGQCYCDCGFAGANCSITG
CPCTDEFCFLSEDGACPLLCGRNLASKCTGSDVLELPVADRPSARIASDAGRCACTSKFW
GPSCNMTCPGVNDDGSGDVCGGLGSCSVADGTCSCEPCYAPNPTTGICEDAPCPTCLFDG
ECVCVNGEKTCSCKGQRDGDTCELCNCLNGGSCNAITGECDCAAGFYGDLCDFACTRETL
CNGHGTCNGPLRRCDCDADYVGDEDHQCEFYCPAEACLNNGTCSLSNGTCLCQMGYFGAS
CQNNTCQLDPCQNGGACRMDFFNKEFGYTCECQPGFEGQNCEVDIDECLLGNDCYGADCI
DKINGYTCKCKPGYIRVTPTACVEIDECRVGVHFCDEHATCMNVPGGYECVCNDGYAGTG
FACSNVDECALGTHTCDDHATCADTEGSFTCTCGDGYLGDGLTTGVGCQEYCWDNPCMYG
GECTFTRDNYTCTCASGYEGTNCELNATVCAALSPCAPGATCINGRVVAPGEFPQFTCNC
SAELGHPSCTVLRPAASTQTLLEGKTAPFVFAAIGGGALLLLIVVAVALRRRSSSNSTDT
KTASDMADDSTAAATTTAATVAPGVGDALMASEADGKAEVLHNTDNAAVDDGDASAAAYA
DTSQLRESVLVEDESDDGEDDYARAHDVRAGAASEDDYDNTRGGNMKSDVGDDDDDDDDT
YASAHAVGAVESEYEDDENEATEPAAMASKPVANTNGDSQTTASSSSPYYAVNSNGSVGE
HSVPVYEALRRNESSSVLLASTLAEFADKQ
Download sequence
Identical sequences PTSG_05617T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]