SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_05657T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_05657T0
Domain Number 1 Region: 435-489,521-582
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000327
Family Cadherin 0.0029
Further Details:      
 
Domain Number 2 Region: 606-723
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000314
Family Cadherin 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_05657T0
Sequence length 2254
Comment | PTSG_05657 | Salpingoeca rosetta predicted protein (2255 aa)
Sequence
MQRLVPVVLLLVLLAVLGHSKSSSSSSNSSSTSDGGLAGEDGRSIVRGHLLLPPTSATPA
TPATTATAWVGLVLEAADGAVVIRVRASRASASANVTAVVTHADGTCTFEAAQLSQEAQA
AVGGDAGSLFYATLAPNTACSTTTTTTTHATNGDAPAVGVAVLVDGKTVLTTPQQPQQQP
ALNALPSAMLQRFSPLLFQGVVQSLNDPANPTASISPLLPSTATSSANAAAAGGVLIATY
SSVNVTLYPEMFNVTQPLTISIHDRFQNTLLFSTQAFQGPVEVPVRVLGPAGQVANPLAD
QRFIVHVAFDEAPQLPPASPSTQVTFTSLLNPEPWLVPMPVVDTATEMPAPEQRMLACTP
PSNAVLATWSHANTQCRVQASRNDALACVLVQGRWCVVQQQGTNVPYPTDGGDLAVTVTL
SSPTGLRTVSQRARISVQDINNNPPVFPSPSSSSSSLSLAVRENLPAKSLCGRVRITDDD
VTFPPPVVTILRTLPARDIGDGDDTIEPAGYPFAVGAVSRERPGVFLVDIFTTATLDREA
IANYTLLLRADDGTHTATAPVSVTVTDANDHTPALVAVSSAACTRTSPPADATGSSSACA
VWAVNSPAVPEDTPLNTDVTVLSAFDADSPLSGGGRVFASLVTDATRACTAADSQFFQLI
ATSDSDDDGGGSAAAADVSARWALRLVRRLDYEARRVMRVCVQLEDAGLPPRAATVAVDV
HVSNAVFEMNAIGDGAWIYSAARGLPLTAAATTTTAATMSTSSSSSSSSLSSSALSLRGV
PLAHRLSSIFPLPASEFVALPAAAAATITLAFNGEADTEDIDVAVNTDANTDASSTTTSS
SSSAADAADVHVRVAHRVNPTEETDCVMSEWIQLPVCYDASTGLPIDADEWAAFHSQQQQ
QQASSSSSTSSSTPPLSYAHVLASNDSSDVVRPLVRFVVQPRDANGYGRDCPRYDTRALQ
ESRVSLASTVRGPIGVHVYPSETPPYGALYTLRFAPCLQAADASANTEAFPDTLSSLFDV
LNGTTSNSGSDSGSSNNANININNNINNNNNSNSNSNSTSDAVRGLLDHLAVLSAVSDSS
ARNGYARNNRDLDGWRVGGLRVPGDLTTAIEQAEAAAAASGGEDGGGDAGVVVVAQSRVS
TQQRPLSSLLASLLSGAGDAAGAGVASAGSSSSSTAVDIYDGTWAVCDYTMGGSSDASTS
NCTITITPMSSSSSSPSPAVLDAVTGLVSVTPGLHTLQIAAEVNGKVARVHDIPLLAGNA
SDFAAAHTRSTCAWSPSPDATTTTTTTTTTTATATAAASSSASSSSCTASSSSADMSSSG
DGVDWDRVSLASGPAAHLSDLDGLWRRMMKPSQKGAGGVGAERTTVTLGTHPSYLSIGPA
RLTSPFVVRSHTCKGDGAGVLTCPSAFTGSHSGSRALAASLLAVAQGYTDVIVAPTSNAT
AADTAPFGTDTSGTGGGSGAAGAYESQALSSHVVQVASSPGFEWACQGLASAGIEDADDD
VTMATGATSTTAGWDLSRPTAVAFGVDASPSSAFFVSWPAQEFTQAASVSFVAACTSASR
FLACIVDPPSTSSSSVHLPCGEYDAVDEVYRATLPLFYGTNTVRVYCVDDTGSLSPLPAS
IVQTVDQDPPTLRVTALPSDCTEPTACVTSAREEGVAALSADEPGTLMCRHGHTSALATT
TSACCRAVVAAVQREWENTTLANENGDDVLSSSGGKSPDGDVSGGGGGEGVLPGVVANST
VAAECEQLCMSGLLFSSFADAIQRNMTSADARGDIAQAASMGVSADACFGSLSRAVRAHM
SYSACVQAELRTTLEALVAVETPVIAIDEVVSSDGEGRRSGGGDTPSTLEAISWSEWTEC
NGAVRIRASTSNTSDTSDTSDSIADGSTFHVSSAHGQVVVHQVVAADVAGNRASTAATAL
TSAPFIAWLVDAQHRSNGTLAELLAFAVGVEEAEEAAQQRAAAIARALAACPGTSTALVA
TTVLAGVLCAACVLYLAYLHVTWDACVDRASKRGEKSFESTAPRAKHALQQAFELIHMSD
LAVDGSFEINPGFVDTTEDDLVANTSFLYGLGLHAHDDDDDDDDDGDSDDDDGDNAGSRF
VGIGASFVGDKHDASVLLRHDPSQHQHGQEQGRAAVDQRGVGKKSVQHQQPQHQQQHGGV
SAPEDPAGWLPGGLDEPPMLSDAFAALGGVHDEHGDGGGDEGSEVEEDMSSFGFHTVPAA
TAAANSGGGDDSSGEYYNGSDDDDDDDSDEDDFV
Download sequence
Identical sequences F2UBU7
XP_004993526.1.12839 PTSG_05657T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]