SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_05882T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_05882T0
Domain Number 1 Region: 808-921
Classification Level Classification E-value
Superfamily Cadherin-like 7.2e-17
Family Cadherin 0.0031
Further Details:      
 
Domain Number 2 Region: 1693-1786
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000000567
Family SH2 domain 0.001
Further Details:      
 
Domain Number 3 Region: 1039-1126
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000667
Family Cadherin 0.014
Further Details:      
 
Domain Number 4 Region: 1239-1344
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000002
Family Cadherin 0.0037
Further Details:      
 
Domain Number 5 Region: 1477-1572
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000257
Family Cadherin 0.011
Further Details:      
 
Domain Number 6 Region: 1122-1244
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000414
Family Cadherin 0.0085
Further Details:      
 
Domain Number 7 Region: 913-1018
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000143
Family Cadherin 0.0064
Further Details:      
 
Weak hits

Sequence:  PTSG_05882T0
Domain Number - Region: 700-810
Classification Level Classification E-value
Superfamily Cadherin-like 0.000432
Family Cadherin 0.01
Further Details:      
 
Domain Number - Region: 522-546
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00837
Family Integrin beta EGF-like domains 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_05882T0
Sequence length 1864
Comment | PTSG_05882 | Salpingoeca rosetta hypothetical protein (1865 aa)
Sequence
MHHARILTPHVARVPSSPFSRQHNCPRPLVLRTAPVPEPRLIVTPVSKIIDEGEDVTLSF
SLTEPIICRSVFDDCRVLLLITNARPDEIALSACYLQWHADEWDVTKQITVSGVEDFVDD
GEKTFTLITEPLQSNSEYYANFDADDIVIKTQSYQPAQCSSTTDPNQISWDGRRSTFTSS
GTYLLWGAPMRDWEVQTRVTNGRNCAVGVREGCDLVVLDQCSGNGLVMYSDFNNPPSQRL
SVRQESGTNNYIISSARSAAQVRVVVRVRVVFQGMTSCGWSGCRRAPRFSSTRWLDVYGT
APGFDFGYVDRANAANTEPRTRGLCGSYDNDRSNDPINGNGLVIPSSRDFFRTRKAGACT
PYSRPEPDVAFCEAPPRPVQRPVLRSPDIEDLTELLKTLDIGDDDPRAAYEFDPQEVGSI
FLGDEQVARYENLCESAITGSLAADVCAEVGVDIQQYIDNCIEDLVTQQDEDLILGAIDS
MKEDCEFLASTNITLFDQDEAGNLVPGQLQRAVVERLCPGDCSFNGVCNNGTCICNDGWS
GADCSTNITVVPANNGLFPFSCDINTACPTVITVSSEQLLPGPGLNCLVDGEETPGRFIA
SAQMQCAIPRVNITGAQERVLPVRISRESGEYSTARPFIFYDGRCKQCTRDGECTIKPNA
CVIDNQCVLEGQAPADNPCMRCQPQVSQTAYTPAFEDAQCAPEIRGLDSYITVSEGTQRG
EEVAAFTVGNTFAEEEYDVVLSSDGENDGASDVFSVLDRGNGAFALILFDNVDYEATPSY
ALTVAATGRSSGLVHEVRVSVDVLNVNENPAMDQDAYTAALPENAAPQFLFRVSATDPDS
VLVRDAVDARYSEVSFSLTGFRFASDAALFAVNPTTGEVSTTGPLNHEDRGEYVFEVVAT
DGAGARATATATVTVTNVNEQPTFVRLSQIFVHEDAALGTTVGTLSTVDPDRDNTFTYAL
LNGTDLFAIQGDALVTAVEFDFSGDNKDVPLLIRSADQGGLVVEEVITVRIVNQNDAPTA
IALVQVEHGKDASELTTPLTAIPEDTPSDSVVGLFKVTDPDASDLHILTLTDDADGTFAV
SGPALILVKPLDFESTPTHTIRVIATDTGFPPLTSPEQAFTITVEDRPDAPREIALVPST
TITENTPAGTVIGVVRARDDDPSQPMTIEVSQECPFELSGGVDCANSEQGHTICTAQVTL
TRQIDLEGPAYKCVVTATTTADDGLFGRETIVVPVENVNEPPTSVALSPATIVEGAPAGT
FVGFLSATDVDEGDVEFEFALADSTAANARFAIKRQLDGGVERAAVVVAGDLDHETRPTE
TIMVTVTDNGGASATLPVEIAVTDRPMHIAINTTVIDEVVRPSEAVGQEVAHVTLVNFDR
DDLTVVFTVSAPTEDTGLARRSADDVAFDVLPSGQPNTARLVIRDGSLLDYESLPNHVYA
FTVRASFVAAGGSSGSGVAVPAPVSSTIEVEVRNVEEPPVFNTPEVTAPVGVAPNADSGT
PVVVLSAYDPENAGDVTYAIESGNDDGIFIIGSTTGEVTVIRTPETTGAQLDQMFELVIV
VTDSTGAHSSRFVLPIVLDTSLATTSATSTSTTTSTADTTVDPSIVVDPTAPGGEDLESK
GSSNSAASSTIPVVIGVCAGLLLVVAVALLLFVRGRRKELHPSFASTPSTMDNPLYHGHH
MHHAPVSGFVDGFSSQLYPWYRAEMSRADCEMELLNRAAVGEFIIRDYPTSPGWYMLHVR
TGTAEVAEVKIRPQGQEGKFVLVGDNSGAAFASLPELVQHYAATTSPVLGVALVAASGAR
QPVVHQYDDVPAVMRRGQALEEDPNAPHLPLKSHQADMIAQVASGDDFYGNTHAARDLLG
SSAI
Download sequence
Identical sequences PTSG_05882T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]