SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_05886T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PTSG_05886T0
Domain Number - Region: 79-269
Classification Level Classification E-value
Superfamily Tropomyosin 0.000366
Family Tropomyosin 0.0015
Further Details:      
 
Domain Number - Region: 492-729
Classification Level Classification E-value
Superfamily Tropomyosin 0.019
Family Tropomyosin 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_05886T0
Sequence length 963
Comment | PTSG_05886 | Salpingoeca rosetta hypothetical protein (964 aa)
Sequence
MADVARPHRPNNDPYVGDDEDLHSDEYTGGGDNAGSGEDPYADAYDEGDDYDDDEDFDDD
DLPPDHPALQRVQEALRRQLTSRLQEVTEELQEKSQKLKTSKTEREEVGVQLYSVQQQLA
KLQAELEKTQDECNRLLQDREQEEMLLSQVKAKHAEHEQALKEQSKEGDAIQREYDELSR
KVLLFEKHAEELEAKVKGAKRAAGKATKEQTKMEEEKQKQDEYVDRLRERVKDLERDITL
ARKQIEAQKEETEEARGNLREAQMEIDEIALRKREVQQLWQHSITGLGKRNEALSAMQKA
VREQQQEVFARQRELEGVDRNIKAEQETNEGFSLQLSRLETEVQSVNKKIDAIVAQQDEV
KAEYSMVNKALQDTERQLERAQQDANIRAGEVRMARDKQDRLAKQKVALEEELVALMQQK
LTVDNASKGAAKSIKQVRDAIEQQEMLLTDIENEAAKNDVRASDYEARIEALNKDRKDLQ
AHAQELDQQIREYEAQSKQQFVAIERKQAQIDTMNKKLGALRERLAAEGAGNEDMSPAEI
TIANLRKDIVSVSKDNGELQDRWLSKQSELVSIERQAEDQRNAIDALRTKRIVLQEQQFR
LEQELNSQQKEIATQEKQFKALQQELVKLNTLIARNRGVQEDLQSTNVLMQNEFTRQLKA
EERETVQLQTQIEDLHGERERLLNAVIEAERQLLLWEKKIQLVKETKAEIKSNEGKEELD
SMRSEIHRMNLKLQSILREKEELITEMERCVDRRGNIGAKARLQAKKGTNHTQSIRKEVM
DLKKRVKTALSDIRLCEEEIDLKQQRQDEVHHALRERQERFRALRQHLDELASMKRQKMR
QRMHNLEDVVDAQAALKHYQAVTKGSLKLRFKDASSYERSIDKQMTTLQHLGAIIDYLVR
EYPDLEESFASVRDTLGFKLSKFRRATADMRGADGGDDDIEEDATSMADTTITTSAGSRR
SNR
Download sequence
Identical sequences F2UD27
PTSG_05886T0 XP_004992779.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]