SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_05908T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_05908T0
Domain Number 1 Region: 10-184
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000304
Family Tropomyosin 0.0097
Further Details:      
 
Weak hits

Sequence:  PTSG_05908T0
Domain Number - Region: 199-381
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.000214
Family HBL-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_05908T0
Sequence length 788
Comment | PTSG_05908 | Salpingoeca rosetta predicted protein (789 aa)
Sequence
MQRVRTVQAEMSRLQHQHHQHHHDSKTLSAYDLNHGLKQLQRHRKQLETKLSSAEEQVKH
LTDTIATIEKSRRSLQRQNDKLDADLRMRESELETFARKFDFVKTHTHMAVATSEDCRKL
FDTLSAFKADMETTIQQQDDELDEVRASYKALAESKQELTAAKATLMARVEELEQALQAQ
KKTLNEALLAKQREVEALDQRLANTNTQLTNTKEELQAWKYKHDKATSDIEGLKSRLEAT
QTQLSDSRDESQQLQAKLAKAKEEHAKELEAARQAKDAAEADLNAQLGTAQASLQASNDE
LAKLKAHWSANASAWTAQAQDHALALDALSVVIQQQDRNLLQSRKQHHDATATITSLQDV
LGKAKGNVEELTAALKQATDEGAKLQKAVSEKDTLITANHERIAALEQQVLAMQEEKAKH
AKAMEESVTQAQQECRDLENRLKEIEATFKEATEELSAKLKVQTEASTALEKQVQEKEAK
LAEVESTLAATQEARDKGKAGQDELQATVAKLQAELLEAKAIKEQDAMWKDKAEDFEAQC
TALQAEVKRVTEAKEVAARKMGSVLDKHALEAKRAKEDLAKEKQIVATLKKELEEAVAKA
SKFELMAEAADKAPVSPDSPPSSASDSEAKDDVAVEPPKPRSTPSTVAPSFPVPARKKVS
KTPRASQQQTRRKAAATPKTPSTPRTRKRTTTSTPKAPVAATPKPTSTPRGKRTSATPKL
ASKAPKRRTKDVARVQEADEYAFADAEKTPSASRFSRHRSRRAIAPALPRKEQQQQWDFM
FGFAPSSP
Download sequence
Identical sequences PTSG_05908T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]