SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_06002T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PTSG_06002T0
Domain Number - Region: 56-84
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000113
Family TNF receptor-like 0.0069
Further Details:      
 
Domain Number - Region: 2-53
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0029
Family TNF receptor-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_06002T0
Sequence length 89
Comment | PTSG_06002 | Salpingoeca rosetta predicted protein (90 aa)
Sequence
MCTTDCITYSTFVTGTTTEDRTCELCEAGKFRADTGHRLTECEACADDTFQSDEGQSSCM
ACNECEPGYVIDQDCTPTSDRTCKGADGV
Download sequence
Identical sequences PTSG_06002T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]