SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_06003T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_06003T0
Domain Number 1 Region: 337-381
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000108
Family TNF receptor-like 0.0064
Further Details:      
 
Weak hits

Sequence:  PTSG_06003T0
Domain Number - Region: 167-220
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000294
Family TNF receptor-like 0.0059
Further Details:      
 
Domain Number - Region: 121-164
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000383
Family TNF receptor-like 0.0056
Further Details:      
 
Domain Number - Region: 86-123
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00145
Family TNF receptor-like 0.013
Further Details:      
 
Domain Number - Region: 281-437
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0033
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number - Region: 228-280
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0224
Family TNF receptor-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_06003T0
Sequence length 454
Comment | PTSG_06003 | Salpingoeca rosetta predicted protein (455 aa)
Sequence
MLRMRTLAVLAIALCIHALAGLQCAGAVGKTCNNGGGGQDCAQDGSEVCQLGSCMCAAGY
GYTGDDCVECGFQFYKSSAGNEACSETIRCDKGERWFKPSNTEDATCPPCPLGKYQDKTG
HRDTQCYDPSTCEAGKYVTQEPNTKQDRECGLCEPGKYTGAPNQPTCNDCPGGKYQNAEG
QSECKDPTVCMPGEYIMADPTATTNRICFHCVEGMYSDTTMAEQCKTCDSGKYQDRHAQT
GCKNWRTCGRGKKWTAGSTTDDATCSNCGPGKYQDEIGHQDTSCKDCPTGEFQPGSGASS
CEVWTTCGQGEKWISGSATEDASCLPCGSQEYQSKTAHQDMSCNAWTTCSSGYYVTADPT
SSSDRTCDKCDAGTYGDTTNADNCKSCGPGKYQDVSGQTDCKDWKMCSQGEKWTSGSSTE
DATCSPCSPRHYQSKSSHQDTSCTSWSTCGPGMR
Download sequence
Identical sequences F2UDE3
XP_004992895.1.12839 PTSG_06003T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]