SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_06031T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_06031T0
Domain Number 1 Region: 474-498
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000055
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  PTSG_06031T0
Domain Number - Region: 429-466
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00012
Family Complement control module/SCR domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_06031T0
Sequence length 499
Comment | PTSG_06031 | Salpingoeca rosetta predicted protein (499 aa)
Sequence
MQRTAEAAHQATQRRISQMLQQAYVDLKPGTMFKSKDDVFRALAAVAVFHGCNHYVYASD
TFAIRVICGNEKRRQDALNMNASDPSPLGCLYCCTSTIQPCGRFRVDQLGIHTCRNSNRT
VTSQTLARVDQAILGTGLQMFGPVSIMVAITHWMARRRLDVLAHAETHSSPLTSFAAEEV
AASWGAAAGPAALDIEHGRVHVHRPNVQPHQPTVTVANGVCNCIYHKNYSGLPCKHIVAI
NHPRAHTIHDMFKQAVYVQAWHDFGLRVPLEASSVPCDMLPPPAVIQPGRPQENRLERQP
RNRTRLFPPVLPAPVYGPAAPPPLMHAMMPNLSTTPVITSILTPLQLPMTGAGWQTSTFE
DSVVYSCHSGNVVYDTTFGSTLTTLLPPDSTSAYMTSFTRTCRADQTYTNTELACHDVNE
CDPDAQDQPRTYQQQALYTCDDGYTTTGDAQATATYTATCTATGNYTFQGTFVEVDECAA
QPCMNGGVCTDLVNAFECA
Download sequence
Identical sequences PTSG_06031T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]