SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_06032T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_06032T0
Domain Number 1 Region: 188-288
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000111
Family Cadherin 0.0031
Further Details:      
 
Domain Number 2 Region: 402-498
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000013
Family Cadherin 0.01
Further Details:      
 
Domain Number 3 Region: 704-812
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000127
Family Cadherin 0.0078
Further Details:      
 
Domain Number 4 Region: 1018-1127
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000186
Family Cadherin 0.013
Further Details:      
 
Domain Number 5 Region: 1205-1289
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000228
Family Cadherin 0.0078
Further Details:      
 
Domain Number 6 Region: 503-618
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000443
Family Cadherin 0.0065
Further Details:      
 
Domain Number 7 Region: 1519-1604
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000514
Family Cadherin 0.0056
Further Details:      
 
Domain Number 8 Region: 904-1014
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000343
Family Cadherin 0.0075
Further Details:      
 
Weak hits

Sequence:  PTSG_06032T0
Domain Number - Region: 1286-1397
Classification Level Classification E-value
Superfamily Cadherin-like 0.0003
Family Cadherin 0.01
Further Details:      
 
Domain Number - Region: 1404-1510
Classification Level Classification E-value
Superfamily Cadherin-like 0.0003
Family Cadherin 0.01
Further Details:      
 
Domain Number - Region: 289-398
Classification Level Classification E-value
Superfamily Cadherin-like 0.000814
Family Cadherin 0.0082
Further Details:      
 
Domain Number - Region: 137-177
Classification Level Classification E-value
Superfamily Cadherin-like 0.00728
Family Cadherin 0.0089
Further Details:      
 
Domain Number - Region: 1603-1639,1734-1790
Classification Level Classification E-value
Superfamily Cadherin-like 0.00976
Family Cadherin 0.0095
Further Details:      
 
Domain Number - Region: 627-700
Classification Level Classification E-value
Superfamily Cadherin-like 0.0642
Family Cadherin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_06032T0
Sequence length 1859
Comment | PTSG_06032 | Salpingoeca rosetta hypothetical protein (1860 aa)
Sequence
MLLVKSAAPLNHEANPVVTTSISSIDNNGAVVTSTFNISVADINEPPTDVVVHAINDTSQ
QPLQQFLVPEQPAHATTAAQPWLVGAVRRAGSGTRPTPPQNPHPFTLLRAKFETSRPSSV
VPNGGTRLRQHRQPGRVVSHETTPTITFTITVQDSGGPGDNDPPLSTTTDIVVRVVDSND
APQGLVLINATAAVPENAVAGTFVGTLAVTDEDMDETITFEILLGGEFLAVATPQPTACS
GGAGLCTADVVTMTPLNFETTPTFTLLARATDSVGSSTTQFFTIAVQDVNDMPRVLGLTN
TVVSEAPSSPLPLTIATVMVDDEDGDVVSCSVLAPADAAFTIESAAPASGETQPQQQLVL
VDAQPIDFEASQTFDVTLACSDGNGATTDATFALTVQDVNEPPTAIALSSTQVAEDVPVG
STVASVIVVDQDAGDTHNVTVASEPAGVFEAVRNPSTGTYALVLASPLDFGTQDSIAVII
RAEDSAHNMLQTTIAVSVLDANDPPSAVTLQPSSLNEHSAAGTVVGIVSATDQDDPSATT
PITIHVLAGHNSGLFEVQPINTSAPQQQQQQQQQLRVFVGAPDAIDFEMSSVVEVDVQAE
DSEGARGPVTTLFIDVVDMPEAPRQLSLQGDVVEENAVATAVGVVSVLDPDAGGTRCTAT
LNTTSAAANAPNYEETPFVDVVVVATDLLYTVFNTFNITILNELSTASVAENTPPGIPIA
TIVAFDEDRSGDEHACQLLSGVDSALLSLVACPALSRWPRDSTIFVLSDNDGGRLTIAQT
NEVVILADAPLDFETQPTRTFNVTAVDLSGIPVSRQPTDPEGTPVSFVVGGQDSAFVAVD
GAVDGASIVLAAPVNFEGGGSSSSDARLFFWARASDGVNDSPTTHAGIAIGDVDEAPSSI
VVSPTRVLENALPGAVTLSVTITDPDEDDSVVITGIATDPANIDITIQTQPSCVSVPPRE
GNNGTLAAGYTECSGAVLTLNQPLNYEQLPSFVLTLHTADAAGAQTTATGSVEVANLNDP
PTSVAPATVQLPENSAANTTVAVLTVADEDAGPAGTYTCALRHLSAASWPFVVSGGKRVL
VDPTATASELKAALNYEDTPVLLVEVTCTDGSTATTPLAINHTLTVQLTNVPEAPTDIVI
VPGSVPENSPAGALMSNAGGRFRLQGDTLVVASGAVLDHEPTPQLSVALGAFDPTFRYVI
RTIAIPIVDVNEPPTMPMYEGALTLPENAAPGTVVGEASAMDQDDGQTITFSIGVSFEVV
ATDSDAVFPLSASTIVTISLTNANDAPSTIAFEGSFTLPENAPAGTPIGVVIATDEDASD
TLNITVYESSSSSRISGVRAGVTACEPGEGGVGVVCRAQVLSTHTFNYEELLASSATMRP
IVVEVTDTVGGIASASTSFTVLDVNDEPTDLVAPALPLLLPENAVPLPYTVSTLTLEDED
QVQVSPVSCTVDGAYADSFVATATQGTQRIAVQATRTFDYEEEPDTFDIAVACQDGAFSI
TRTFPVRVLDEPDAPTAITPMQISVAENSPVGALVGEITAVDPDTFDRHSFAFAALDFED
ESVRETTLLVRVTDSTGLFADVNVTLIITDVDEPVPSFTVAPAAPIPERTTSPTLAATLT
AVDPEGDLVTFTVTDESQAVATGARACLAVIPPVMPAAATMPSDTITTISTTTTTTTTPA
PAFTGSGDGTVVSSGDGDAGADEIVDTTATPVSTTDATGTVPTPAADPSQTECRTSMTVT
SSDSVVLMIVPGADGLDCERWPVFNVSVHASDMMDTTSGITHDVPVYVLDEPEPPRDVQL
TATAVSESTAVGTIVARVQAEDDDACSQLTFAVHDPTNTFVLAAPMNASGVQFKNLGAG
Download sequence
Identical sequences PTSG_06032T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]