SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_06040T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_06040T0
Domain Number 1 Region: 7-181
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.57e-34
Family beta-glycanases 0.00013
Further Details:      
 
Domain Number 2 Region: 240-330
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0000000036
Family Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_06040T0
Sequence length 332
Comment | PTSG_06040 | Salpingoeca rosetta predicted protein (333 aa)
Sequence
MWGIAYPFPYLNLYNATATALKSVHPSLKVGGPATMQVQHVADFIHNTSARGIPVDFVST
HLYPSDPNCNLPSTRNDPDCFAHTLQSTQKIAAAAHLPLLITEYNDGLEGTPPHRDTAYA
AAFVFHNVPLVQNLSLFSWWTFTDVFEEGGMNPSPFSNAFGLQNIYGVAKPVYRAFQLLN
DAGRFALRTTVTQPSSQPPTGQVRVFATINSTASAPVHEKLQSLRVHVSNFLRLDMGECG
NNTATITIPTTSPPPASLSARVYALDDWSVNPRAEWTRLGSPVYPTQQQLNRIFAASEVT
PSAQELKITKEAVSFTTHLRGCSAYLVTFHVQ
Download sequence
Identical sequences PTSG_06040T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]