SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_06068T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PTSG_06068T0
Domain Number - Region: 105-204
Classification Level Classification E-value
Superfamily Cadherin-like 0.00124
Family Cadherin 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_06068T0
Sequence length 571
Comment | PTSG_06068 | Salpingoeca rosetta hypothetical protein (572 aa)
Sequence
MDENSPAGTVLATVELVGGASGDSLTYIRPNGLTLNGNNELVVEEEGVVNVESGTMFPSF
SVRISAMCTDIDIEVTVTDSNDPPTAILFDGETIPGPPTPLSACLVFPEDTNTHLIELST
VDEDINQDHVYTLSGPDAALFAVVGGAHLGLAAAIDYEKHANHVFNVTVTSTDQAFTGQH
GGAVAGGLQVSQEVCVRIADMNERPMFSQPVYDESAITILGRAFALPLNVSDPDINATLS
FTVINATRLLPPSPIVSNSSTPTATASPTVNGTVTTNSTSITNSTTTTSNSTSTVAMMNT
TETTTMVSTEVAVEARFVDATDFIPIYSPSLPSSSSSSSQSIMMPLLYVNNVSLGWNDLR
VYVHVEDEGRLSTEALLRLNLTVLPVPPATTTMFVLFNATTSTTTTITTTTTTTTTTTTT
TTAARAASASSWTKNGVTVAAVMIALVLVIALLLYIVRITNNTQAATLQHKRFKMMATAA
MRGKIGKNRRRGGGGGGGTDSGSDSDSDSIGSGSSESDSDDDVVINVGMRPGNVLEMQLL
SPSSQQGVSSLRPPSTISAPVDAEDVALLLE
Download sequence
Identical sequences PTSG_06068T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]