SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_06114T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_06114T0
Domain Number 1 Region: 66-336
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.53e-20
Family NagZ-like 0.013
Further Details:      
 
Weak hits

Sequence:  PTSG_06114T0
Domain Number - Region: 637-666
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0989
Family TNF receptor-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_06114T0
Sequence length 992
Comment | PTSG_06114 | Salpingoeca rosetta predicted protein (993 aa)
Sequence
MAQASMTREACATLCYPLNFSPQAPWSTATNVFAAPKLNSPAQFRRLPPTATSRARERPP
RATKELPVCNSSLSICARLDDLIGRLSLQEKAGLIGPDPVTSPCAVVDYGVKRLDIPPCL
HLAEMNTAVGSACIISQDKCATTFIEAHRSWRSLQPLLAISTEMRTFNNLNWHRGGGVLQ
KIGLTDPFLSGEYAAAYVAGCQDGPDKKYKKMAAGLRHVDAHSVETNRMAFNGNISTFDL
WDTEVCIINGVPSCANSILLNDVVRGQWKRDTVTIGTDCAVAKTLNGGADMELWETCFTT
NGNLEQTVKHNRTTIDTVHNNTVRRVLKDSFITSQWHRGVHHLYTLTSSNGPCISEYPDV
VHYPIALSTTTPRTTAVCHVPRVAWAPGPPPPCSASSDAVCSPWTECKPGQKKSVSGNAV
RDHRMCVSCTLWHRVPAAAGPHFVLPTSMCEEPFIETIPPTLTTDRMCSCDTLACNKLIT
QLFEEMVCAWPTDEQLDVVLDVCCSGPGEDGIHATIRQMDAYAARRSCPGCTDTCECSAG
FILVYDADSADCRPCDGVTEFSPSVGGSKYEPIEECELGQEEVAAPTRSSDRVCHDCSAR
TIDLDSDGSTGCQPTSPAAQAPTTTTATLPPTPFHDVTECAPGFEEVQAMTLLISDRVCD
ECPGGHVQGCLWPGRARFPITTCDAGEEETAKPTPYQRPACAASASLAPPSSPSTARPSH
AAPSRSAHDRLCRKCVQDTCVPVSSYAAWGYISTLDREQVQVLHLPEARRLRSTLTASAR
QEVVGALVAHIGTGQAQEVDAAIPPEAAAPVRVLMLNGILDCLSNLHFIHIWQLFRVLTT
LTFDRQRIPAAGLIDHEKEDGLSQSNDELKRIGTIAATTITHTWLALANDAGISIDGNHL
SSLLQTLQLIYVDNSSSYQEQARLSGCVNGDGGLTIEPPPPRPLGFRSLADPDVPVCWPP
RPPSARSSTTTPSTRLWFARTDGCAPHAGDVL
Download sequence
Identical sequences PTSG_06114T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]