SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_06159T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_06159T0
Domain Number 1 Region: 370-409
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000327
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 2 Region: 257-299
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000839
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 3 Region: 411-449
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000185
Family EGF-type module 0.018
Further Details:      
 
Weak hits

Sequence:  PTSG_06159T0
Domain Number - Region: 183-221
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000295
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 447-489
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00117
Family EGF-type module 0.0089
Further Details:      
 
Domain Number - Region: 51-100
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00788
Family EGF-type module 0.012
Further Details:      
 
Domain Number - Region: 100-196,232-264
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.014
Family Growth factor receptor domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_06159T0
Sequence length 990
Comment | PTSG_06159 | Salpingoeca rosetta hypothetical protein (991 aa)
Sequence
MQQQLQRGRIALPLAASVVAAAAFVLCTCVCLLPAATQAQQTSLVLVPGSCDCTNDADCG
CENNAECVDRANNTHTCMCRQGFESRRCETAYDPCDGTPCGTGNCTYSSTVLRDTADFEC
SCTKEFVGDTCDVPCPANCTSCIELNDKGICTQCDSGFAIDNTNNECVTECPFGTENQDG
FCNDINICLNITCANGGTCDRNAASDATACICPTGYDQPRCLTGQACNGVDCGNGECYID
DGVAKCDCDAGFEGTNCTINIDDCDPDPCNGETCIDGINNYTCSCPSHLGGPNCEVQINC
AAGACEPNGVCKSIATGFECEWCAVFAFVCLPRTRSQQQQQQQQQQQQQQQQQQQHCSDP
GWEGDSCTDDIDECAPDVFPCLNNGVCTTPTINSFHCECPTGFTGDRCEESPCIPSPCTN
NGTCSVDDITGNFLCNCTGTGFAGSICQYVDKCVEDPTLCGENVCESTGSSYVCVCPDGS
KQKNCPPPTTTPPTTTTTSTTSAASTNAPAKDKSLLTPPVQYGLMGAAALLAVVFTIGLG
CYCRNNRPTKAARRKTRPPSMMRSFSNPAFNPDIDSEDYLTMPGADGSTSDGYMGLDAFQ
NTSPTKRPSVPRTAWQKKSTHLDGIQEEGSYDDLGSDEEEKLEGYLEVGTADASASKGAS
TGATTAAAATTTPAGGKVATAAGGKKAAAPNAAKGGKKPGKKPSGKKPKQQQKPAMKQQQ
QQQQHDSYMDLEDDQGQQSYMDVATAGTRPVAKPTTYSSVGAQPPQDNYLDVDNDQQPQD
SYMSVQQQQQQQQDNYLDVDNDQQPQDSYMSVQQQQQQQQDNYLDVDNDQQQQDNYLDVD
NDQQPQDSYMSVQQQQQQQQQDNYLNVDNDQQPQDDYFQVDKSTGRYMSVDRSQQQQQQQ
DSYLNVTRNDAANEGYMGFDEGDDDSSSDEEDFSIIPKQQQQQQQQQQEGADGSYMHVSS
PQQEGGNDSYFDVEGAAKNPSYLHVAGNKS
Download sequence
Identical sequences PTSG_06159T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]