SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_06248T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_06248T0
Domain Number 1 Region: 75-212
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.7e-20
Family Calponin-homology domain, CH-domain 0.0039
Further Details:      
 
Domain Number 2 Region: 1471-1548
Classification Level Classification E-value
Superfamily GAS2 domain-like 0.0000000000000114
Family GAS2 domain 0.0018
Further Details:      
 
Domain Number 3 Region: 1390-1452
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000378
Family Calponin-homology domain, CH-domain 0.0058
Further Details:      
 
Domain Number 4 Region: 1225-1263
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000278
Family Calponin-homology domain, CH-domain 0.0057
Further Details:      
 
Weak hits

Sequence:  PTSG_06248T0
Domain Number - Region: 246-299
Classification Level Classification E-value
Superfamily GAS2 domain-like 0.00262
Family GAS2 domain 0.0062
Further Details:      
 
Domain Number - Region: 472-726
Classification Level Classification E-value
Superfamily Tropomyosin 0.00536
Family Tropomyosin 0.003
Further Details:      
 
Domain Number - Region: 911-999
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00968
Family Myosin rod fragments 0.015
Further Details:      
 
Domain Number - Region: 986-1077
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0785
Family Myosin rod fragments 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_06248T0
Sequence length 1587
Comment | PTSG_06248 | Salpingoeca rosetta hypothetical protein (1588 aa)
Sequence
MSHHGRASATFSVTSSTVGLRSMHAGLNMDDVPSRSGSKFNNSYLDASWRSRPDSSYLHG
GTSQHQELTLRRKRRQWVEQRLFAYREDLADWFSLLFAKNITEASFISDIEDGILLCRLA
TMIDARYAESDKTRGYAVGHTQHRGSIAHTKLRYNSRAAKGTFFARDNVSTFISWARNLG
IDETVLFETGDLVERKNEKHVLYCLMEIARVQDVLEPPSLIKLERSIDRNGFIAVDTDAL
EAAITDLCHRLNTPRSRIERLSPGFYTVDGREFYLALIRDRVLVRNGKHWDPLEHILSQA
PENGASRPATAGDGSGTTKPRRPSATAAAPQPSGRSPSSTQLGAASGDAQPAATSPRSAA
FASAPRSPLDRSTSNLDGDAVSSRGPGSGGRGPSSAPLSASGLTLPVPRGRSGRNTSTSS
GGVGGGGAGGGVDDSRSSSQNTSRRRSNAGESVRPAILQDSLHGPAIPTHDNQALLDEIE
ELQRRVAELEGDLTEAEAACDDERCAHDDTRAQLADLKDRLAAQPSSDDFAELEAQNSEA
AQRLKDCIDDMERMRDDYDAALERKDQELAGRDSTINLLQEQLDAAAAPANVIEPEHVEK
LNAQLADAHAAVEDEKQKSAALQEKADALGELHRVHENTRAELEDALDRICHLEKLLADE
ESSSAAAVAALEDELKSAAGEKDSAAAENAQLKADNDSAQDTIKDLNNTIDAQTKELDRL
REELENAGGDAARAALAQGELGEKADMLAAELAKERAAAEAAQEEKEALKKEVDDKANAL
AAAEAERDAALKQAEDDKAAADAEADALNDEIADLKSKLADASKALEDKDGLQSVLQDRD
AELALLREQLDNKTKESEDLQGKLDELQKRADELAGKLAAAEKEAADLQSNADAMARENE
KASGDAERALAECSEARSDLEARLGAAESSLADRDDELAKLRVELDEAKDALATAQGEAA
DLKQELEDKSTDIEALNDTKRALEGQVEELRPELAATKEDRDAKQEQLNSANDRIAEIEA
LLANKEADADTSAAESGALQEQLQQLQIQYNLLQEGMIKAERKCEEEKKHLRDDRDRAID
DVVLLEDLNGRLLADIQALEERCSSLMLRLQQHEENLQDLQGLAQESQDAVLTLRRQKEE
AEEEAAASRADRDTAQAELDAIAERERQEREAEEEEERRKREEEEEAARLQAEKERQEAE
EHERAMKILEQNKELQKLHQNLGPAREDVADWINELLGTNIQPAALFHELQSGTVLCQLA
NVIDEHEEETRLGEESEGTGKGTGTRKPKSTATSSSASPGAASKKPSSSAAKSRGLRTPR
TGAAAKSPRVKRKASNHPSVLTRASCPSAYEPIRRKRRRIPRYAYKPPEGQSVLGNYIKT
RNIPYCPFEPKAKPGTTKARDNVNNFIRWARELGITDPDVFRADDLLHLKDPRRVLWGLF
DVARRTRAIRVPRVVWLERLRYMQPTKAVKGDALDAAVRSVVNESINQPRLRVTRIAEGK
YTFGEEMTKPLLMRITQKNVLVRVGGGWQSLRKYLETHFPTDPRVKAEKQRLEPIWDKNR
EAPKKYDSADGHKMNFQTTRNDMLFHE
Download sequence
Identical sequences F2UCD1
PTSG_06248T0 XP_004993138.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]