SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_06299T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_06299T0
Domain Number 1 Region: 767-932,1081-1211
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.26e-74
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 2 Region: 131-343
Classification Level Classification E-value
Superfamily Kelch motif 3.14e-24
Family Kelch motif 0.019
Further Details:      
 
Domain Number 3 Region: 679-719
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000307
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_06299T0
Sequence length 1235
Comment | PTSG_06299 | Salpingoeca rosetta hypothetical protein (1236 aa)
Sequence
MTSRGMAVVPATVVVLVVAVAAVVLTAATVVPQVAAAPAGGGRGANADFHKQRTGGDSYV
GLLQNHDSERSATMKLPFTCPSVQLMAETNKKSATSKCTGEIPVINDKDINKLRRPDRDV
PMLSPDPRAFHTGVHAYHPRTRKPVLRVHTNHTPIARAGHSLTTIGDVLVMFGGVMNVPG
PIVNETRQLQVLGDTWVYTCGSPTPDWVQQSMNASGTTTTLPPPRHSHTSVVLELNISGS
WQKYVVIFGGTNSTTVPVSSHSSFFNDMWAYHPGNGTWTLVPATASGSDGLPQMRHSHSA
VTTADGTMIIQGGAGVQGEHLRDIWEFNPTTLSWTKLQPWFTSPNSAFMEAIRSSPDSLS
HRDSWGQVSIALDKNAVLAHSFLSFGGFEADRFSSQASSRIREYVRPLAPGHDHLVLWRE
AGNTAGPFSRTLGAAALWARPKPANATTKLKLKCSSLPWTWNNVTYTGCAKPIGFDRFIC
RVEYFSESRPPRCWDRTAHPEFLSLPPKTQDNEEQAFFYDFCDDTSVLLSGGVFNGDADH
IGVIDSPGMVWVLTDDFWALDGIVYTTDENDLPRSRTDQPTWRLLTDPGDNCSATASVRH
AAHTMDVIGGLRGRLSLPSSETIVAPVGCTKGHYSHSYFDLPCDPCSKGTYAPNSGHFCC
ISCPADTSTVDNGATEAGQCAACPDNYCKHGSCHFNNRTQRPECHCSFVYLDDRCDIPWV
IVFTVVGGFFVFAGPVVVTWYRRYKQRLEVKEISAEQTRQELEEMHQSWMIAIEELEHLH
LIGEGACSTVYRADWHNMRVAVKKLRPALLELDPTGFTEDFAREIRVMRSVRHANIVTFY
GAGREGMVPFLVTEFMARGSLQDLLQERDEPFPLDVKIRFALDAAKGMRFLHYHNPPWIH
RDLKTANLLVNESYTVKVADFGTSRLASLDKPNTTPVRRQSGSTHPTPGKKTKGKKKKDK
KSTKTKQSERTPLLSPSGGAINDDREDYLPSLLDHPGPRHARARTSTHTPTSSTPTSSSS
SSGDRRDGGASRGGEERAVVQTPTRDRPASIRAEAGSEGDAILATPPGGRFVRSRLPFAE
SIAMTGNVGTPLYQAPEVISEEPYSVKADVYSFGLVLWEIYTGVPPFSDFPKLSLHGLRA
RVVAGDRPTVPLDCPEALAQLIRECWQPRPAGRPHFDKIVQTLLRISDTTSKLPKHTSNT
SVRRVSSGIVHMPPPSTPPSRRSQEERSESFTFVT
Download sequence
Identical sequences PTSG_06299T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]