SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_06426T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_06426T0
Domain Number 1 Region: 89-352
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.000000000000432
Family NagZ-like 0.012
Further Details:      
 
Weak hits

Sequence:  PTSG_06426T0
Domain Number - Region: 392-432
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00361
Family TNF receptor-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_06426T0
Sequence length 1018
Comment | PTSG_06426 | Salpingoeca rosetta predicted protein (1019 aa)
Sequence
MTREACATLCYTFNFSLSAVEYGYQCFCGTQAEFHRAVSAPSSDCNEPCTGASTEMCGAA
NRMNIIQANCSGKPLPTGHACLSAATKELPFCNASLSIGARLNDLIGRLSLQEKAGLVGP
DPVTSPCAFLDYGVKRLDIPPYVQLVETNTAVASACIISQDKCATTFIEAHRSWRSRQPS
VISTEMRAFNNLNWHRGGGVLQKIGLTGHFLSGDCAAAYLAGCQNGPDRNGSSDAASFAL
RGSRVIYTAVTTPSRRDNRVAFNGNISTSDLWDTEAQALAAMCSYASINGVPSPCANNML
LNDVVRGQWKRDMTPNGGVDMELGETYFTTNGYLAQAVKQTRTTMDTMHNAASTSARPAD
PSLTSSNARCISECPDGKYELGQRQPHQSRIAHCPLDYFYAKAHRCVPCTTCGMGTWASI
PCSASSDAVCSPWTECKPGQKSVSGNAVRDDACVSCTLGMEYQPLSDRASCFSTSMCEDP
FIETIPPTLTTDRLCSCDTFTCNKLITQLFEEMVCAEPTDEQLDVVLDVCCPDQGEDGIR
DTIRQMDAYEARHSCPGCTDTCECSAGSILVYDADSADCRPCDGVTEFSPSIGGSKCAPI
EECERGQEEVSAPTRCSSDRVCRDCPAGTIDADSDGSTGCQMCPASHYTEAGSHGSCSSF
TCHASTHDHHDSDPATPCNDVTECAPGFEQVQAMTLLISDRVCDEKLEGTDHVCSQCELG
ATFKPVERPGRVMPPRHSVRECEFGTFQSQVPTLDSNRECTLECSECPSGRFEIRACSAL
EDVQCAGCSACPPNTYILRACDSGERPTRKCTILDVCDQDQFGLFPAPTPTTDRICRDLT
QCNPSTDRAPYGHYVPAGSIDSCEQFLCPAGTADLDRNARLAWTLPPSLAQRDCTDVTEN
TDICSPWTQCSACATEYELVAPSLVNDRECQHMRSCKDTEREGTIIATVASINEDFTARL
FNRSVSGDITDMGFTASNKLLKALDAVGFWDTTAFVGSDTSSSDGGCGSARHGNSTDS
Download sequence
Identical sequences PTSG_06426T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]