SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_06435T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_06435T0
Domain Number 1 Region: 492-576
Classification Level Classification E-value
Superfamily E set domains 0.000000000000882
Family Other IPT/TIG domains 0.079
Further Details:      
 
Domain Number 2 Region: 137-220
Classification Level Classification E-value
Superfamily E set domains 0.00000000000168
Family E-set domains of sugar-utilizing enzymes 0.04
Further Details:      
 
Domain Number 3 Region: 319-399
Classification Level Classification E-value
Superfamily E set domains 0.00000000000336
Family E-set domains of sugar-utilizing enzymes 0.017
Further Details:      
 
Domain Number 4 Region: 766-851
Classification Level Classification E-value
Superfamily E set domains 0.00000000000378
Family E-set domains of sugar-utilizing enzymes 0.068
Further Details:      
 
Domain Number 5 Region: 408-490
Classification Level Classification E-value
Superfamily E set domains 0.000000000924
Family Other IPT/TIG domains 0.031
Further Details:      
 
Domain Number 6 Region: 50-134
Classification Level Classification E-value
Superfamily E set domains 0.00000000778
Family Other IPT/TIG domains 0.032
Further Details:      
 
Domain Number 7 Region: 222-291
Classification Level Classification E-value
Superfamily E set domains 0.0000000322
Family E-set domains of sugar-utilizing enzymes 0.039
Further Details:      
 
Domain Number 8 Region: 579-660
Classification Level Classification E-value
Superfamily E set domains 0.000000056
Family E-set domains of sugar-utilizing enzymes 0.039
Further Details:      
 
Domain Number 9 Region: 672-757
Classification Level Classification E-value
Superfamily E set domains 0.0000000591
Family E-set domains of sugar-utilizing enzymes 0.04
Further Details:      
 
Domain Number 10 Region: 7963-8002,8045-8097
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000397
Family Proprotein convertase P-domain 0.021
Further Details:      
 
Domain Number 11 Region: 2394-2445,2478-2530
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000638
Family Proprotein convertase P-domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_06435T0
Sequence length 8978
Comment | PTSG_06435 | Salpingoeca rosetta predicted protein (8979 aa)
Sequence
MELLLLLLLTTALSPVKAATTTYETVDITLISDTGATVVFEQTFELLDDANISTVVPSFG
QVGTRVTVSGQLLLGGGTRISGATLAGVPARRILSSNNTLVVVEAAASDPTPVGDIVLTA
DTGALTTIRDAWTYRPQGNVSAITPSSGQRGTHVTITGSNLLGHATRLATVTLGSVQARI
LEAANERVVVRAAPAPAGNVDVLLKAESGAEVAVPGGFDYTPQGVITGVQPSSGQLGTFI
TVTGTNLLGAAPSLATAAFGTAQPSQATIQSATNTQVVLRAGAEPAGPGQGRTNLTLTLT
ASTHAIIDANDTFSYVDASSIDTVAPSSGQVGTRVTITGQRLYGLGSSIVSVTFNGVEAR
DIVEASPTRVVAIAPSAPATTGLADVVVTADTGATAIASATWTQLEESVVSSISPSSGQQ
GTRVIVTGFRFFGGGSRIVNVTLAGVPATIVIALPTLVTLDAGYGANSTGDLLMIADSGA
ETRVVDGFTYLDPGVIAAVRPATGRVGTRVTITGKNLLGGGTFVEAVSLAGFPAELVSAT
NSRIEVVTARGLEGTGDVAISTSTGATIVRPNGFSYLSAGQVETVVPDMGQLGTRVTLAG
RNLLGGGSTLVSVKLVGVEVQEIVSANNTQVIVVAAAPAPGSLPSPAIGDVEFVADTGAR
FTAIAAWRYRTPGAITDILPTSGQAGTFVRLTGTSLLGGGTAARRVTFGASVTADVIAQS
STALVVRINVDEATALVASDAVVDVTIESNTGAIVTLPASFALRATGRIDSVSPATGQVG
TRVTIAGSRLLGGAAALDRVVLAGTDVQAIVSESDTQVVVIAGVNVPSSGDVELLAESGA
VVTLSPNAFTYAPVNAAPEVQAPAAVTLDEDASPVPVDVTVADSDAEEYNGTMVTNLRCT
EGTISVDGGLRRSSRITVVGQLRVINHQLNGLTYKPNPNFFGNDTLVVDVDDRGNSGSGG
NLTASANVTLHVRSVNDQPVLSTTAVAVLPTINEDVSEDMNEGATAASLLTGLVTDPDDA
MFGMAIVHIANSSAAGTWQVVPAAAGAAPVNLTAAATTPANATLVGPYDHLRFLPAPNFN
GRATLTFRAWDLTQHAPLAVVDTTQAASTASSPFSRDTTRAVVTVVSVNDVPEVLLNTPS
GNYRATFLEQSSTGALILPSSLTITDADHATLDSARVEIVNREDGEAEFLAANSVVTANM
GLSLLVEASNTTYTIVIRSRSAARMPISNYATVLKSLRYVNAADEPNPATRSIALTVSDG
IDASPVVHTYVDMQLVNDHAPVITYTQTQPLVLREPNTSLPLLDTDPLTVTDQDHASFLL
VSAQASITADSLRDPAHERLAVTTPAGFGFTVTFGNGSLAVSGLGTAEEYTAILNSLVYV
NAAEEPTPGPRRVSVVVRDADFESEPVVISVDVQVINDRAPEVDLSGPSQPGIDSAVDFV
EEGHPVRIAASDATVTDPDSGNFTMEAMWVRIDDALDGDLESLVLLPPPELGLGTAVINA
TVLGSSSSSAPVQLGPLSASYDAGSHTLMIAGSASPDVYTAALRAVAYANVADLPSGVSA
RTISVVVWDGGFNSTVARAAVHIIMINDPPMLNVGGPAADDHSNVVHYREGGAPLALVDP
DALLSDEDHTVLAWARLLLVSAPDYTDEVLAVDTTGTSIVASFEHTVNEDRGPGEGKAST
TAEIELAGVEASVWAADAVLPSQFENITADLLNHELGLPGGNETVVVRVLNATASALDVN
GQPASRPIARISLQVVADDRFLSVMSSNLTRVVSSSGLLLTSLKQHSGAYFYVNTIPFVV
EPQTRAFDVVEFYATLTLTGPDALDNFLKVLRTATYQNLESRPGQPSTLTRTVEFVVSDG
NLTSTPVYSFVTFAAVNDAPLVDLNGPTEAGNDNTITFTEETEPVPIAAPNATLRDVDNA
TLAWLTARIVNNLDGAGEVLSAGPDVPSAVQVSYAAGTATLTFTGVASTRRYQDILRGIT
FVNTRDEPDPTPRVVEVIASDGDRASLSRFTTVNMAFTNDPPVLALGTAQATNWTTAFVE
DERPGSPIASPDTLITDDDDTHLTSALIRITNVQDTPAFEVLTVPASVVPSGGSATGNNT
DTLLLSWPATLAQWAAALQEVRYLNLDNDPEVDTPRVVAVSVVDAAATGAGAPQQRSNTG
VGFNGSTDAPMHTTFVEGGSAVALTTDALRVFDYDDDYVQSALVRIENLIDRTLANTFEV
LSVNASAAPALSVQYFPDGFLSITGNATKQAYRALLRTLTYENTFPNPSTQPRIVSLVIN
DGRLTSEPSYAVVAIDAQNNAPMLDLNGVLAPSVSSSALFIQGLGDVPVTSSQSYVTDYE
GDLVQGMNVTITPLPDAPSEQLFLTYTPPPPGHVETLSTSTLNAAIASSCATAPTSFCTS
AVLTSGSAGATVSDVQVVVDIDHPYVGELILTLSHAGRSVQLVANPASASGASGQCALAD
FVNLHFSDRASQSVTTRCASAEGYTGSVRPENALSAFDGLDMGGDWVLEVQDTVRFFSHG
SLRRFALILTSGTRTYTTWSASQAVSPSAPSSIPLSVSSASAVVDADVHVHLTSASVEDV
RVSLTSAAGADAGAAPVVLKDFGAVNGPCSTASTGSLVFDTRVDSTAAGHVAAADTCPAY
PTSILQPAAPAQPLHDLVDQVSLGTWSVLVETRAGVTATVHYVELRLAERPNVEVGYDAA
QGLLTIRGADSADVYTSLLQTLRYNNQQVLPTPVERVLSFVVSDGQDSNADANITLTTHN
QPILDLDTASGDTSLDTSVVFVEGGAASPILLTDQSSLSTDGLFQIQSAHVRLDNPLDGG
NETLSWTPTNASTAAGITAVALDAEAHELLLTGLAGPGDYLTALTNVHYHNSDRNPHADP
RVITTTVTDTATLTSIPRTTTVFVHPVNDPPELYNASRAAADAVFVEGAADGTPVVSEDL
FVFDADNAFFTRAMFAIVNPLDGAGAESIVLDSPTATDPAVFTVADASSWPSWFAPPGSV
VVQATAVGNVTLDQFVDVLLGAKYMNTAIEPNMTTRHVRFFIRDTLNASNVVDSYISVQL
INDNAPVLSLVPPPFDATFFEPNGSCVLHCTEAPVFNGNFLITDDDQNDVFPLYGAMVAL
PNNSADLALERLSVSAALLAQTGLDALYVPDNGTLIITGEATVGDYTRVLQTLTYHNTAE
EPDPAQRLLALTVFDGRWASNGLLVPLSIVLINDQTPVIDLNTATADANIDTRVAFVEEQ
SAPLPLAPTALLSDADSGFLLQYPTNISHVVVNLTDARDGALETIDATASPAVAVQRAGP
HLLRLQGPSSPAEFTAVLRTVRYTNVADEPRYPRHRAIAFTAFDADFASDPAYAIVDIIS
VNDVPRVFLSGGTPPPTPADVNTAFLYTEGQGALRVAPDAVLEDDDNTQLQWLDVELVSP
PDGLSESLNANATGPDANVTVVPATAAHHMLRLQGPASLAELQAVLQTLTYTHSEYGPGN
PDTSQRQVRVVAFDGTNTSVVAVAFVGFDSVNDAPILNLNGGGADPDFSATFTEEQGPVP
AVSAALTIMDIDGPIIDAARVAFTVRDAGLEFLAVNTTNSNLTAAYDPATGVLDITGNAT
TREYASVLATLTYDNRADEPTPTPRVLTVTASDSIAWSVPVYSTVAIVLVNDPPRLYSPV
VGRTWNVTFVEDHAPAAVVPADTVVEDDDDAFFVQVTAVLHAAPDAEAEVMRGNTTTASG
NALNETLTYDAGTGATTLLAQGYVSLDDVIDYLRSLVYENLSDAPTPSVVRRITTTVSDP
HFAPSNAFVTNIRVQPHNDAPVLTAATTELDAIAEDASLQENNGTDVYAQLRSLMQDFDA
APQFGVAVVGVDTYGGEWQVAVPVVPVDTGMSSGSSNATGMSANATTAMPTTVPTGPMFR
WQAVPANASITSAFLLPLTDPFTIRFVPKKDFFGRADLTFVAWDHTQGAPLQANVDATYA
SDGAFSRDTSVVAIDVESVNDVPVVLLEGPAAAAARNGDGNATATFVEQGGAVSIVNSTG
LSLWDVDNFQLQYVDIDVTNPRDGDADVLLIQAETEIEGLVVERIDAWHVRLGVGASPSN
ASHAPLYDDLQYRDNQTVRLEAALRSLAYNNTLDEPSLETRVDHEAEFPMQAASVRFVSA
GDVDAADEALWVDAGVVGSVPGLSSWYNATTRTLSVRGPAPYSAYAAVLATLTYNNSAEE
PEPGPRAVEIVVDDGVFESAPARVDFDVAVINDRRPVVYVGDAGNGVVNASVVFTEEGPA
VSAVGADAGITDADSGDLALAAVRVVLVDGRDGVLEELSATDGGSSNISVEYNSTADPYV
LVLRGPALRTEFVAALSTLTYRNVADEPSGADVVADGDDGSARRTLMVTVDDGLFVSEPA
YTHIEIAMVNDEPLFDAGGNGMPDSTVTFFEASRPLLLFDPQSAVTDSDDTILQNASIVL
SPTPDSPDEYLIVADQGTSITVTATNDDTVFELRGPAPLSEFTAVLRAVAYVNTVTDPRK
PTGGSRIATVTLDDGRARSESTATIQFQAVNDEPVLDISGPAVPGRQYATEFVEEQAWPV
PVVSENLTLTDSDNTTLVAARVVMQPVPDQENETLLWDTTLAASAGLTAAYNVSSGELTI
GGEAAVSDYEALLRTLAYFNNEDEPSPADRLIRISAFDGLAWSIPRTTTLKIVLTNDPPR
LYYPGDAPDVNYVEDAPPVLVFDQGLYLQDDDDLDMQTAMVTIDNVQDTDHEFLTFADSP
VATGITAFRTNDTTQLSFAGVDSIQHYLRLLRSVRYRNTDQGPTTSVLRSITLQVRDAQG
GLSNLVQVYVNVSAVNDAPVQDEHTTQLPAVPEDVGTSNTANPGLPILNAIVDSTDVDDD
AVMGMAIFSADSANGTWQWQPATGSAWNDVPSDTSVTNAVLVAAGPASRLRFVPNANYHG
SAALSYYAWDQTQGSEGDLVDASVRPQTGALSDAPSHVAITILSVNDRPVLDAARVANFP
TVLEDVPPSNNSGLSIPELLNGSVFDPDLLLHNGVRLPDTSVDGIAVTGADSANGVWEWS
SDGGASWTAVDTDVAPAQALLLLSEPRFRLRFLPAAHFHGTVPLTFVAWDGTRGTWGQTA
STLSSDADEPFSLASATAHQEVASVNDQPVLQAGTQTEAIFEDIPDAENAGLSTAYLLQQ
GSAADNDSDATLGVALVRLESLNGEWQFTLDSNATSVTWTPVSANTSDARAVVLTSADTV
RVRFVPNPNYYGSAELEFRAWDQTDGAASGSVTGVSLVKTVALKPAFSDDTRTLHLNVTQ
VNDSPVVSTSLVTLPTIDEDTPPANITGATFESLLDADVSDVDDYSDYGVAVIALDRRNG
EWQFRNGSHTAWVTFPGGIAETSAMLLSKTSTVRFVPFKDFYGIADLQLRVWDMTQYTLG
QQHVDAQNTSPFDSFSAQVVDVRAPVESVNDVPVVLLEGPAAAAARNGDGNATATFVEQG
GAVSIVNSTGLSLWDVDNFQLQYVDIDVTNPHDGDADVLLIQAETEIEGLVVERIDAWHE
GPAVSAVGADAGITDADSGDLPLAAVRVVLVDGRDGVLEELSATDGGSSNISVEYNSTAD
PYVLVLRGPALRTEFVAALSTLTYRNVADEPSGADVVADGDDGSARRTLMVTVDDGLFVS
EPAYTHIEIAMVNDKPVFDGDAYSGAPVVVEFVEGEGPLLLFANGTLADADDTILQSAVV
SLNARPDGDQEFLLVNLTGTALTRVDVSDTVLRLQGPDTVANFERALRSLAYNNTIARPG
KPTAITRIVTVTVDDGRRNSSAVTATVTFAAVNDAPILALSPTSFDFEATFVEELGPVLV
VSPALSLVDVDNTSLSWASVTLSPVRNGRNESLWVNASDTGLTWSYDHGSGELRIVGPAP
VESFEQVLRTTRYNNELDEPDATERTVTFVMSDGLADSIARQTRLNISLTNDRPFADFEW
ETSRQRADYNAFTHLPTTPALRTFVEGTAPVPVADNLRVGDDDNTRLIQATVNIANVLDA
GLEVLYYYETDSRIVSFASNGTHTLTLSGLAPVAAWNRVLSSVAYANLDTNPDTSAPRRI
DITVSDGELTNVATEPALVTVVARNNVPHVVPSAVGSTHLTTILEDETENDGTRVSSVAV
DSVQFTDADETTAFGVAIVNASDTLGTWQVALASESAVAGNGTVMYTWVDVDASSLAPSS
AAILLGPNDRVRLVPNTHANGVTGLDVRGWDLTGGVNASTSPQDISVLLADTERGPFTAD
VLPVQLTVTAVNDAPWFVTMTNVTTPEDVALTLPQVVLNDVDAAEAPSSPYTVTAAASVG
GLRVNDSDAFQPQLTFSRPLAEANALLANLAFLGPANYHGMATITITASDNGIAGVGQPL
EAATTVHVRVLPVNDQPVFEHALASPFEVFENDVADGTGSRISDNAVVIGVGANVTGEGV
FSDVDEPTASALGLALTAVDATHGNWSYRTADMPAGVWTRITAADAIGEENALGLPPSAL
LRFVPTAFYYGPATFTARGWDQGERSAAARASGTAVTSLNATTSLVRADAPFSQQPLVAT
VQVLPVNNGPEAFAPAALTMWEDMGPFNVTAVSVFDRDADVAGGVTTTVRVSTGTLATTA
TAGWSSQLVLAGYVADVNAALATLQFDPPQDFVGDAIVTLNVTDHGRFGAGAGPKTAVAQ
TTITVQPLNDRPVFATTDPVPPPQALRSILEDVPVADNDGTPVQDLLALASDVDAGTVLG
VAIVEVHNASLGVWQYRANASAAPGSPDAQWRNMSAMATRDDAALLLGSEAWVRFLPFLN
VFGTVQLRFKLWDQTDGGVSGQDNADTTGPAPTSAYSLQTATALLDVLPVNDVPVVSSTH
PTNVFTFVEDGAPVRVAQAVSVVDVDDTTLTEMRCVVSGIRDEGSEALLLDSPAHGPHAL
SITRTATTFELRLKPFNNGERTLAQVRDWIAAVRYVNTADEPTRGRRTLTFTVLDHVGES
LPFVTSVVMSMINDHLPALAAEADGATITFVEGTAGDSVALLGPGTVNVSDADHADQFYI
QRAVATLTPAPDGDAVEQLSVDAQNLTATYASAGGVGVLEVVGAGAFGLYEQVLSSLAYV
NSAEEPTLGDRTVSLVINDGLFNSTPPVTLTVSVVGINDQPPTVLFAGNTPTGTAAFVEE
GPAAPVMPAVTLGDADSGVSVITAAWLRLPQHVDGAGSEALALNSAAQSLASSEGVTVSI
GDDGAALNLTGTATPATYQAILRGVLYDNTAVEPNHPDWREVQVRVSDGDLLSSPTHVNV
SIVRVNDVPTLDLGGSALPGDGFVLSYTEGDGTVRAVAADAVVGDVDNTVLEALEARLSP
FPDGAALEMINMTVNTPATPNLWLASGTNATRVVVRGPAPLAEFVTALRSLTYTHAGAMP
GNPDTRPRAIEVRASDGDGWSATATSSIVFTAVNDAPRIDLNGKAPGIGYQTTFVEEGDA
VAIASTNASSIVDVDNSTLASLTVTITNPLDGPAQEVLRVDTNASAAAAIPTAQIAVAYD
VATSTLTASGVAPVAGYVAVLQSLAYQNLADEPSPQPRILHVVASDALRDSLPAVSQINI
QLINDAPALHLGAASTDPQALNFSTVYVESTSPGAALAATASDLYLNDDDNAQLSRATVE
LLNAADGADEGLYPPVTGLNGGVAVGTGTHMLELRLNASLADWRAVLAATTYRDASENPT
VGDDRVLRVRVFDPVGAGSAPAYVHVRIAPVNDAPMFSYTASFGAAAPTLNYTEDASPLP
LAPSGVVRDYDNTHLARATFVLENLQDVGLAQQTEVLSVDRALAQANGIFVDYDRSGTLR
LVGDAPVAAYQALLRTLTFVHYSQNPTASPQRRISGYFSDGIDNGLMQLVFVNVIPVNDA
PVVSASGSGVFIQHGEPVRVFDAVALTDEENNHLQNASVWIADAQDDALENLTLTYTPPP
IENSAAGRKLGLATTTAIDTPCADEPGFLCAEDTMSLAASASAPNTGAVSAVFVSMQLQH
DMLGDVRAYLEHDGVRVLLFDRLSASTSTAAGAGDCQATTALFHFADGAGTRANQACARD
TGAGEPLASSIEGSFAPASSLAAFVGHAADGDWTLQVVDTYLPYRFGQLLDWSLVVTVGT
RNITLSPELVAASGPPAVALPTTPYTSLSDVPHSGVVTDVDVAVFLSLHDSATEVRLRLA
HPDGTAVQLLTKIGGGCAFQGTGAVVLDGSAASPITFNQLCVDLSSGRYFASEPLSTFHD
KLAAGEWSLTVDQVDVGYVALHGWALSLTTRPNVGVSYSASQHALSLVGEDTLEVYSVLL
RSITYRNDRYRPTGTSRDVRVRVADADPSNVAGVTVLVHRAAVVSLGATPAMLNNTAATF
VEKGPAITIAPAASIEYDDVFVLSGATVRITNVLDNGFESLAANVSHPLLTVSAATQDST
ELEVSGEAPVAVYEDLLRNILYTNLDRDPDNTTRLVAVTVRDTANLFSDVHFSHITIGPV
NDPPELVVGAGDPYTLATSEHVEHGGPTQVLPVGATLFDADSPTLSSATVKLLNSLDVSM
DTLQLNDPAFVSDVSTTVVLCASIPSFVPCPHSLPQTVLTLTPAPQTTATVAQMLQALSS
VTYNNTADEPDPGPRYFELSVSDGEDTSILQYVRMDIVLVNENPPSLSLDPCECTGQTLA
GAPEGYGSFCFNHANPFPDENGPFCFVRPSCPKAQATVQGLFFAYCSELQYTEGQAALRL
AGNGSISDNDDPARFPLYSLQAVLVDAEPQERLFLLEDVATPAGLNVTYNATSGTLRVAG
EAHLSTYVAVLQQLAYTNNAEEPLDQNRRVLVTVYDGASDSNTVSRIIEVNLINDQTPVV
DLSGDAAAGIDYDNVTFVEEGADVSVVDAQRLTVRDDDSGPFLMQWASATIVNGQDGSAE
QLYVTATSPNITSVVYTPANYTLELRGAAEASEYERVLRTLMYGNSADEPQPPTERNISV
VVADDSHVSAAAVSRVRIELTNDARWPFDLRTSLASAP
Download sequence
Identical sequences PTSG_06435T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]