SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_06458T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_06458T0
Domain Number 1 Region: 2196-2324
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-29
Family Cadherin 0.00067
Further Details:      
 
Domain Number 2 Region: 2829-2935
Classification Level Classification E-value
Superfamily Cadherin-like 4.43e-29
Family Cadherin 0.00041
Further Details:      
 
Domain Number 3 Region: 1758-1887
Classification Level Classification E-value
Superfamily Cadherin-like 5e-25
Family Cadherin 0.0013
Further Details:      
 
Domain Number 4 Region: 2613-2747
Classification Level Classification E-value
Superfamily Cadherin-like 1.14e-23
Family Cadherin 0.0011
Further Details:      
 
Domain Number 5 Region: 1334-1451
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-21
Family Cadherin 0.0013
Further Details:      
 
Domain Number 6 Region: 1979-2083
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-21
Family Cadherin 0.0014
Further Details:      
 
Domain Number 7 Region: 1436-1557
Classification Level Classification E-value
Superfamily Cadherin-like 1.2e-20
Family Cadherin 0.00079
Further Details:      
 
Domain Number 8 Region: 2299-2422
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-20
Family Cadherin 0.0021
Further Details:      
 
Domain Number 9 Region: 2936-3047
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-20
Family Cadherin 0.0027
Further Details:      
 
Domain Number 10 Region: 639-780
Classification Level Classification E-value
Superfamily Cadherin-like 9.57e-20
Family Cadherin 0.0042
Further Details:      
 
Domain Number 11 Region: 2509-2626
Classification Level Classification E-value
Superfamily Cadherin-like 1.26e-19
Family Cadherin 0.001
Further Details:      
 
Domain Number 12 Region: 3041-3137
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-17
Family Cadherin 0.002
Further Details:      
 
Domain Number 13 Region: 1229-1337
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-17
Family Cadherin 0.0013
Further Details:      
 
Domain Number 14 Region: 761-901
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-16
Family Cadherin 0.0016
Further Details:      
 
Domain Number 15 Region: 1543-1659
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000186
Family Cadherin 0.0041
Further Details:      
 
Domain Number 16 Region: 1871-1972
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000106
Family Cadherin 0.0016
Further Details:      
 
Domain Number 17 Region: 2084-2200
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000942
Family Cadherin 0.003
Further Details:      
 
Domain Number 18 Region: 2409-2501
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000117
Family Cadherin 0.0049
Further Details:      
 
Domain Number 19 Region: 2722-2836
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000571
Family Cadherin 0.0012
Further Details:      
 
Domain Number 20 Region: 1652-1762
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000157
Family Cadherin 0.0021
Further Details:      
 
Domain Number 21 Region: 3515-3562
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000016
Family Fibronectin type II module 0.0074
Further Details:      
 
Domain Number 22 Region: 1015-1119
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000642
Family Cadherin 0.0046
Further Details:      
 
Domain Number 23 Region: 1112-1223
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000002
Family Cadherin 0.0038
Further Details:      
 
Domain Number 24 Region: 600-651
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000148
Family Cadherin 0.0094
Further Details:      
 
Weak hits

Sequence:  PTSG_06458T0
Domain Number - Region: 889-1018
Classification Level Classification E-value
Superfamily Cadherin-like 0.000171
Family Cadherin 0.0085
Further Details:      
 
Domain Number - Region: 88-321,720-765
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000188
Family Quinoprotein alcohol dehydrogenase-like 0.038
Further Details:      
 
Domain Number - Region: 3382-3403
Classification Level Classification E-value
Superfamily Kringle-like 0.00628
Family Fibronectin type II module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_06458T0
Sequence length 3697
Comment | PTSG_06458 | Salpingoeca rosetta cadherin (3698 aa)
Sequence
MTRAALVLALIALLGACASAFNIQDTKVTVTESDRAVYINVDPSSTGEIVTFRTSDVSAS
SDTSGAMSLAFIESGRVDTNVGTAATFFTVDTRTFMATANANGNNVLVYLFDGADFNLVQ
SIPATAPSAVDVFTAASNGETYIVIANAQDAQTQSEMFRFNAQTYAFTSVQTFDTSFAAD
AKVFEHTTADGTSLTFLAFANFKDIGLDLTNYETDSAVYLWNPTFNRFDFLQHVPTAGAV
KVETFTYSGSLYLIFGCQGEYLMQLSLTKPLNYNVESRVYKFDAAALQFTATSASISTTG
LVDLTTFVSQDGTLLLAAAQGVNRTDTSAQSNTQLPIAITTVGSGIRFYEWIPDIDLLSF
VETYDVFAPSALDVFYGGANGDTPYLLVTTRGSESDPTNTSSHSILLTQSAVSQDLFYQV
ASFPTHSAVAVASTVIDSVRYAVVVSQQLQDTLVRGALTEATISAQPTTSSIFAIVQEGQ
DYTARAGSIIFDSPDTVALPIYITSTPGEQEPTEFFTVTLTSLAAADNTTTVTVYIEGDL
DNTLDVQYDAGADVRDDQVYITEEEHPVPLTVATFSIPGFTGTLLCTLDTDAPEFQVSGT
TLKVIAPLDREAQDLFVLPITCMGFPSTTGVSAQAYIIVNVMDINDNPPEFAGINSGIAT
KRVTEGTPADFLVYTYEVTDADLTMSVNFSIISIRTASNEVDYTGPTPIYLDPLTGQLYT
ARVFDRETDGDEFFFTLQVTDTQDPTQFALVDDRLFIADLNDNAPVFSQSVYAVSIPETF
STSTSLAPRSGPGTIFGDVIFTNIAATDQDASDNARISFSITDGNFAVEGGNEFFNIDPD
TAVVDVIARLNYEVPSERHFNLTIRACDYGPDLPDDPFGQQCSDAILSVQVTDLNDNPPV
LDTIDMSAGVEKVGLYYRITEATDNTQILQVHATDADGPNNNHIVFNMEGIVGTATSGFN
ASSTGTVTVYDPVPGVYNLQMMMTNDGVGTLAPQLVPFTIYMYVFDLPAITAPSSISVAE
NVTATDVLATVSAMVTVIDSTFPTFSYTIVGGNDLGKFQLAEGSGTLTLAPGQTLDYETD
PHSYAITVRARDITTTLDRFSEATINIELTDVNDVTPVIAAVPAIPTFAEDDALSTSAFA
QRDVAQLQVTDADTNTVLTYTIDSVTATRRVSGVDESLPSAFSITSTGLLQTAQPIDAEQ
HSQFAVVVRVSDGVNSATATISIASVTNVNDVEPAFGQPIYQATLSETTAVGEVVVTLAA
DDLDFEQASPLVFAIVPQAATTDPENGGSSNFAVDASTGAITLASALDYEAFKMHRFTVT
VSDGRSEDSAVVEVRVSNTNEAAPVFGGFDRAVAIPEDTAVHTVVFTATATDADRNDTVY
FSLVTNDGQFAVDERTGVVTTAAAFDRETTASYRLVLRASDRANASGLLTITEVLVTITD
VNDNTPQFVTQSVFDVAENAAVGTLVAKVVVTDQDEGVNAALAYSLQGPDADKLSIDASG
NVTVNTANATDIDRETQSTLVFDVVVTDLGSAPNTNRVTLTANVLDVNDNTPQLQVSEPS
LSLTMLESTTANTEVARFSATDADATSPHRQVSFGLAGTDAFTIEAYTGRVLLARSLDFE
AMGPGPISFTVTATDGGLTSAPYPVTVELQDVNDVDPVLGDVLAPLTVREERSSAIIGTI
PASDADVVDDGQLRFSIVATDPAFVQARIEIDEVTGELSTSAGAVIDREEVEGGLDAFTV
TVQVVDSGARTATREYTVSVTDINDKRPVFDTSVYMANVQENLAGGTFVTTVQATDGDRA
GTAFATIARYTISGDSLALFQIDASTGVITTTRQLNAEAPLHVPDGGYSFTVTAYDGASP
LPLSGSATVRVYVQDVNDMPPQFPPGTQRAPDFSEGNAAGTVLTTVQATDADRTTEYNTV
SYSIVTDPTGAFAVRANGDIYSTSEVDREEFPNEVCITVQADDGDFQVNTDVCFNVGDIN
DETPVFSTPPQQTFNVTEDTPIGTVVGRVMAADADKPNTPASTITYSLVGPQTTFDIDAS
SGNIILVEALDRETKNAHFLRVRATDGGGLSADLDYVIVAVLDVNDNAPSFTSALAYTVS
EGFNVSLPLFVATAEDDDLPNDDNSRIAFSLAPGSLTDANTGTAIPDNMLSIRVEADGRV
FANSALNREAYQAFSFDLVASDFGTPQLQATATITVTLSDENDNAPVFSNATYMFSLAED
VSLGVFGSVSATDADTGVNALIEYTLLTSTGLFAIDAATGDLSLTAALDYDVPPQMYTLT
VEASDGGAPSMATTTTVVVHVLDVNDNAPVLSRSVYHAVVDENMQGASTVIANISATDAD
SGAFGAVSYSVDMGASDAACASLSLDASSGAVTVDVAFNREELTWVNCTVVASDGGNPVP
MTSTAALSVRVRDVNDVAPVFTPAGPVDLTLAENNAAPSTLYQLSVSDQDTVGTVALSLD
NDFGGLFTISESNELQVTRSLDYEADQRMYSFSVRAFDGVQETFLDVNVDLTNENDNNPE
FTQQFVYRVVQEGTAARTVVAHLVANDRDEAASPADVVYSIVAPGTPYFAVDADLGTVHT
TDVAIDYEMTQTINFTVQAADAGGRIGTVDIQVAVEDINDNDPVFQNAGTYAISVDENTP
VGTEVERVLALDADSGVFGAVVQYVTDSALFVVDNSGVITLGAALDYEDDMLLKSFTIEV
FAVDGGNRQTSVTIAVTINDLNDNPTVFDDSTYTGSVPEHSSMGTHVIRHIRLSDADTVV
TSYSLSVRAMAGDEDTESLFAVQGVAVVFVGSPAALDRDTREEYRFWLVVTDADGQEDTA
MAVVTLTDINDNAPEFSQAQYSVSLAESRPLGRVFAGISATDADAGANAAITYAIVGGNE
EDRFAIDDVTGELSLVASLNFEATTSYVLTVQASDAGSPMPQSSTASVAITVLDVNDNAP
VFTPAAPSMIVYENEEAGPVIGVLAATDADSYAGGEVQRFELVGESDDFAVDAVTGAVRA
LRTFDREQQNQYSVTVRVYDDGAPAQLWSDTELRIFVGDRNDNAPEFGCPKAGMAVTEAA
QVGDVFATIRAYDADSSSTVTHTITAGNCEGTFGISQYTGKLYLRKPLNRKQAAQYELQV
TASDGTFSNVQTVTVLVDMSDINRMKHVLNQVMGIHSGVFSAVDLFEEYPSYENLGTLPS
TTSHMMTTTSMDATSSSTTTTTAAATTTTTTMMMTTTSTTTTTPTTAATTTTMVNATTTM
TTAGTTTTTTTTATTTTTTTADAMSTTTTTTMAGTTTTMAGTTTTTTADATTTTTTTTTT
DDAMSTTTTTTTTTTTTTTTTTTTTDDAMSTTTTTTTTTTTTTTTTTTTTDATTTTTTTT
TETDAATILAIDTVPGTGSDGDSNVYWCSTTAVYEGQWGNCDIYDAFIVQDDKLYSQESM
LEAPSKIVAFQDEIIAIQPQGAASTIEFVQEDGQAIANIVDVTSNYGRAASVAVFITTDA
SLPSTVLVRVSGTVVLTIEIRAPPSSTTVPENPVFTVSGALCVFPFVLNGTVYNSCTCDI
VGQYWCATDRSLQVQEAWDYCDPAYLPSDAPECPLSAAASGLKLSAPKSETQTNSNGDVS
SDNSSSNSSRAALALPATLGVIAAVLVVALAAVYIKSGRRAKFATPVERLNDDCDDSLSA
APEFSELTAVYDDGELMPPTEPRRAFTFASQVTESQV
Download sequence
Identical sequences F2UFV3
PTSG_06458T0 XP_004991838.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]