SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_06480T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_06480T0
Domain Number 1 Region: 420-518
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000914
Family Cadherin 0.0092
Further Details:      
 
Domain Number 2 Region: 543-620
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000228
Family Cadherin 0.0071
Further Details:      
 
Domain Number 3 Region: 240-344
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000271
Family Cadherin 0.0064
Further Details:      
 
Domain Number 4 Region: 197-234
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000204
Family Cadherin 0.012
Further Details:      
 
Weak hits

Sequence:  PTSG_06480T0
Domain Number - Region: 745-838
Classification Level Classification E-value
Superfamily Cadherin-like 0.000754
Family Cadherin 0.0089
Further Details:      
 
Domain Number - Region: 340-389
Classification Level Classification E-value
Superfamily Cadherin-like 0.0236
Family Cadherin 0.0098
Further Details:      
 
Domain Number - Region: 640-725
Classification Level Classification E-value
Superfamily Cadherin-like 0.0357
Family Cadherin 0.013
Further Details:      
 
Domain Number - Region: 53-170
Classification Level Classification E-value
Superfamily Cadherin-like 0.0471
Family Cadherin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_06480T0
Sequence length 843
Comment | PTSG_06480 | Salpingoeca rosetta predicted protein (844 aa)
Sequence
MLLVKSAVPLNHEANPVVTTSISSIDNNGAVVTSTFNISVADINEPPTDVVVHAINDTSQ
QLLQQFLVPEQPAHATTAAQPWLVGAVRVLDPDTADATADPHPFVFDVSPAGIAYIENQQ
LFVDRSALDFESQSSFVIINVTARDARDSSLAVSHQFTLLVQDLNESPSSVVPNGVSFHL
RACAPGHRGRLAHPGATLNYEVRSVFVVTVTATDQGGLSATSQILVSVQDRNDAPTTPTI
TSNRLPENTTALPFVVGTLQATDEDASQMLQFAIDSIDPPHVAPVFALDGAALVYDNTDS
PDVVVSHETTPTIAFTITVQDSGGPGDNDPPLSTTTDIVVRVVDSNDAPQGLVLINATAA
VPENAVAGTFVGTLAVTGEDMGETITFEILLGGEFLAVATPQPTACSGGAGLCTADVPPY
LLELSTSSVAENTPPGIPIATIVAFDEDRSGDEHTCQLLFGGDSALLSLLPPNTLTVAAG
MTVNFEERASLTFAVWCSDVNDGTVFATANLTLDVVDVQEPPTAVVFAASEPVPEVRSQA
IVLGTLSTIDEDAQDSTIFVLSDNDGGRLTIAQTNEVVILADAPLDFETQPARTFNVTAV
DLSGIPVSRQFTYEVADVNEPPTAPTITPTLGNGGDNSSDVTIIPVPETTAVGTVIATLA
STDPEGTPVSFVVGGQDSAFVAVDGASIVLATPVNFEGGSSSSSDARLFFWARASDGVND
SPTTHAGIAIGDVNEAPSSIVVSPTRVPENALPGAVTLSVTITDPDEDDSVVITGIATDP
ANINITIQTQPSCVSVSPQEGNNGTLAAGYTECSGAVLSLNQPFNYEQLPSFVLTLHAAV
PAL
Download sequence
Identical sequences F2UFX7
PTSG_06480T0 XP_004991862.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]