SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_06551T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_06551T0
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.16e-24
Family Amylase, catalytic domain 0.00014
Further Details:      
 
Domain Number 2 Region: 131-228
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.00000000045
Family alpha-Amylases, C-terminal beta-sheet domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_06551T0
Sequence length 238
Comment | PTSG_06551 | Salpingoeca rosetta predicted protein (239 aa)
Sequence
MRDALNKTGRPIYFSLCGWNAWYAPVGWSLGNSWRIHGDVNTWGSAYAAIRTNELLYNYS
RPGGWNDPDMLVGSSPEAAAHMSPQQSRTQFSLWSVMAAPLLIGSNMLNISSYDVETYTN
REVIAIDQDPLGYQGRPVYSTCPPPSLDDINNPNAIIPPCQQIWAKKMADGSVAVNMINY
ALAKTTITCHADCIKAMGLSGKVSVRDVWQHKDMGTFTSYSAAVGGNGNSATLIFKQA
Download sequence
Identical sequences F2UG49
XP_004991934.1.12839 PTSG_06551T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]