SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_06572T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PTSG_06572T0
Domain Number - Region: 361-407
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000274
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 272-328
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00149
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 315-371
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00293
Family EGF-type module 0.073
Further Details:      
 
Domain Number - Region: 182-234
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00393
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 90-143
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00614
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 148-196
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0323
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_06572T0
Sequence length 549
Comment | PTSG_06572 | Salpingoeca rosetta hypothetical protein (550 aa)
Sequence
MHTTEDEDDNSPAWHETLEFPNTDIPSTFSVELHAFDLDGFAGVNHWGDTDDLGRDTDSF
TFDGCNSVSRDHRFDLDGDNKYIDVTINYTPTDLCLSNNGDCGPARSTSCTCVRDEQVQC
QCMDGFKSDTGKDCFPIDPCQTSTFGGCDKQHGVCTYLGPGESKCACKGGYRFASTSDHS
NCDPINPCEDVPGRCGENSLCVYDGPDKFHCTCVEGYESANAEKTDCRPINPCEKEGYGG
CDANTQLCRFMGPNTNECDCKPGFDGADGGSCDVVNPCEDTPTLCGDNSTCIHTGPGIRN
CTCHEGHTSTTGRNCFPINPCVTDNGGCGFENSTRCLFDGPDLASCVCRSGFAGDPPNTP
CEPVDPCSIDNVCGANAECTRTGLHTYNCSCIAGHVSDNGGRNCTHPSSSSSSSSSFVAS
STGSMPPVTTALDPAASQSTANSISAATWGGIAGGVCGLVVLTTAAVVLVKRRRCGRTKH
ADIGINNIEAPGQHEPQVYDNPVFRPSSGTLTYDNVRPTHAHVVRGTHHWREDTYDIGSA
NGERIRDSP
Download sequence
Identical sequences PTSG_06572T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]