SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_06597T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_06597T0
Domain Number 1 Region: 248-290
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000299
Family EGF-type module 0.029
Further Details:      
 
Weak hits

Sequence:  PTSG_06597T0
Domain Number - Region: 426-475
Classification Level Classification E-value
Superfamily Respiratory nitrate reductase 1 gamma chain 0.0418
Family Respiratory nitrate reductase 1 gamma chain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_06597T0
Sequence length 870
Comment | PTSG_06597 | Salpingoeca rosetta predicted protein (871 aa)
Sequence
MGQRRQVECGGAKGKKGKKGSMRLLWLLLTGVLVSLSGLCEGGRVSLRVEKVEHRLALNL
QFAEARTARLEFEIQGRSETLQFPSEQQNPGTWGVLWQSFVADDFERNEKLELDVLYFGT
YRADNTRLDFPRSCDPQQETAVTHTQSRRTRITFTVEYTPINLCNSSACNGGACTCQGDR
DFLCDCAYGAAFEDAQCYSGDFQCSGPSCPSTSPCEALSNPCNNGCHCIATDVDAFDCVQ
LKTCPSSPCTIDNGGCGAHSTCTAISKDHVMCTCMQGYVSQNGDGTDCVEITTTTTTTTT
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTS
VTMTTTATTTTTMTTTTTTLSSSSSATTTTTTTMTVTASATTATVTPRPPRPSRLPPSLS
TSTTTSFAAVMPGATTVSPSTSAASTTTIGVAAGAVGGVILLVAVMLLLVRRRRRGGNPH
ADGKKAADAHVAAPYDGDDAAVCDRIGPVVNPAFMLNDTGRNGHTTDNSNTNTNSNNSNN
NSSMGASTSDRNAPARHHPRDAWGDSGVSGAGEAGLLHGGRRPDSSNSNSNSNSEAFGES
GAPLWLPHGDTGVGNGTTRHHRGGGRAVSPSHAYENMDAVMMGNSTDHQPQQPFVAPTYD
RLDTCTTHQQQQQQQHQQQQQQHHWGGSQEFGDEAEYDVLSGPHQRAPTGARGGKHVYHH
LGMRPTEAAMIADIQAASTHHHQQQQQQQQPEYSVLSGPHSRPFASDVGASYDHLDRSSE
QPEYSVLSGPHQRALAPGSSSTRSQRDSSAAPSQSFPGNTYDQLHRTWATAAGLPPPPEY
AMPLDPHDSAHVGGVSIDAIYSSVQDDVVA
Download sequence
Identical sequences F2UFF8
PTSG_06597T0 XP_004991983.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]