SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_06613T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_06613T0
Domain Number 1 Region: 24-340
Classification Level Classification E-value
Superfamily L domain-like 6.8e-47
Family Internalin LRR domain 0.026
Further Details:      
 
Domain Number 2 Region: 245-506
Classification Level Classification E-value
Superfamily L domain-like 3.29e-42
Family Ngr ectodomain-like 0.022
Further Details:      
 
Domain Number 3 Region: 838-951
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 0.00000131
Family Toll/Interleukin receptor TIR domain 0.019
Further Details:      
 
Domain Number 4 Region: 757-800
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000196
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_06613T0
Sequence length 1163
Comment | PTSG_06613 | Salpingoeca rosetta conserved hypothetical protein (1164 aa)
Sequence
MVLFALLLLLSPVAAACECDAGARTTMLDCSNQGLTALPTGVLRQCPKLRQLDVSDNQLT
SLDWTEFPAGEAQLTALETLVLSNNKITRVIGTATQVVLPALTTMDLSYNQLSDMEAAAF
QHAVPKLASLDLSNNNLRAVSAAWLQHLPDLEGLSLSANNLTHLNGNPFVHQTRLAQLDL
RQNRISVLAAGYFKGLSSLDQLLLSENAIATLPADDVFVGMPVLKGLNLRGNLLHSLNAS
TFSGSLAASLQELDLSRNRFATTATIVDVLRTLTLLSSIGLAGNRLDAVTAAFIGAMPAL
TDLSLNSNRITALPANVFASAGPGLRFVDLANNAIPALPENVFRPVRRLTSLRVAGNRIT
SVPPTVFRGLTHLQGIDLNFNMLTSLHEETFRGLSQLVGLYVNSNRLSALPPTVFQGLPN
LKWLFMSNNTFTTIDASLFFNLPALNIILLNHNALTDITGDWLRITNLTTIALHNNNFAT
VSAPLSALLQHERTQMFSMLHNPSVCVRGLDPDTRAVVLRCDCAEGYFGTSTCTPLSDVV
VFRTIFSAQAGIILENKRLQGGEFTADLSNLPSTPEQGPNLFPFNLTLVTSSGGSDTGSD
GSDGGNGGVDGDGGSQGPSSATTTTTTTTTAAAVTTSHVTVELPVVLSAFAVQGQVLPDA
VDFDAPVPARDVVLDTLAVNQPLPFVDLDVQPNPYIPTNITFAVHGELPAGIANTTRADG
WLEGTLLEAGRFDFTIVGTDLFTLESKAVAHVTLAVANCGPSTCLNAGTCVNHNPDTPDD
NAFHCQCRSAFAGRFCEKDRAVVSRGVDPARLRDGLIGAAFAAAAVVLLAWWIQRERLKK
SYHVFVSYRQATDAPLAERVVRALQACTVDGQPLVVFWDRLSIEVGDNWQLKFLSGVHRS
CMFVPIVSNAGVANIERVSVFDSKPDNVLLEYETALSLHRKRRIGIFPLFVQGGGGGGGG
GMSSDVGAGMSSDVGSHQVGGGGGGDGGGAMKRGCGAGGGELFNFDYDRFPNGPSKTNKN
VPVCETMKQLFAIQGLFVDSERGLSDSDVTTVMSYFTSKVWNGRGHNKQQPRKEQGLGLK
RHWHSNASRSRRARGVVGALVTPRNWRRGHGDDGGSAGDGDGSGDAWVGKGVGVDDTVHT
TTAPTTTTTTTTLTQPLLADERV
Download sequence
Identical sequences PTSG_06613T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]