SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_06646T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_06646T0
Domain Number 1 Region: 1438-1617
Classification Level Classification E-value
Superfamily C-type lectin-like 1.26e-21
Family C-type lectin domain 0.0017
Further Details:      
 
Domain Number 2 Region: 1701-1856
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.31e-17
Family Growth factor receptor domain 0.0015
Further Details:      
 
Domain Number 3 Region: 2401-2443
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000268
Family TNF receptor-like 0.0035
Further Details:      
 
Domain Number 4 Region: 2692-2780,2886-2931
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000785
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 5 Region: 242-325
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00000628
Family Pan module (APPLE domain) 0.064
Further Details:      
 
Domain Number 6 Region: 756-838
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0000106
Family Pan module (APPLE domain) 0.095
Further Details:      
 
Domain Number 7 Region: 336-416
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0000149
Family Hairpin loop containing domain 0.016
Further Details:      
 
Domain Number 8 Region: 2060-2100
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000369
Family TNF receptor-like 0.0067
Further Details:      
 
Domain Number 9 Region: 2509-2699
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000518
Family Growth factor receptor domain 0.01
Further Details:      
 
Weak hits

Sequence:  PTSG_06646T0
Domain Number - Region: 368-388,420-475,603-647
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000146
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number - Region: 2341-2516
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000188
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number - Region: 2305-2357
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000357
Family TNF receptor-like 0.0054
Further Details:      
 
Domain Number - Region: 947-1001
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000576
Family Growth factor receptor domain 0.009
Further Details:      
 
Domain Number - Region: 1968-2012
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000746
Family TNF receptor-like 0.0039
Further Details:      
 
Domain Number - Region: 2236-2303
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00107
Family TNF receptor-like 0.0049
Further Details:      
 
Domain Number - Region: 660-731
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0031
Family Hairpin loop containing domain 0.058
Further Details:      
 
Domain Number - Region: 34-80,186-228
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00314
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number - Region: 142-183,529-584
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00409
Family Fibronectin type III 0.01
Further Details:      
 
Domain Number - Region: 1334-1389
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0181
Family C-type lectin domain 0.029
Further Details:      
 
Domain Number - Region: 1877-1920
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0253
Family TNF receptor-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_06646T0
Sequence length 3111
Comment | PTSG_06646 | Salpingoeca rosetta conserved hypothetical protein (3112 aa)
Sequence
MPLLLRCAVVISALAAVACEASCPDSASPVAGGGSNTCKCQPGTSCTSDSNSAACTHDLD
GFDTFASTQCSDCKCIPDALVHEVVTPTIGTTCYLGGPCPVTWIANVQVEAVDVHLLRVT
TSGGTSRPKLERTIASSVANNGSFPWRVPSDLSPDTMYKVAVVATNNLVASAQTPTFTIA
AVPTGSCPAGYVSTTGSYPGCAPCSQGTYASSDHMTCSACPSGTTTPSVGAAAATDCSLD
NDSPLASFVKYPMHEIEEQDIHQLRGVTLERCARLCIVDVTCKSFDFTAAGTTGTCSLAA
DTRGTSLTHTFVPTDDATTAHYERTDKYGQLILAQTAFVESPDTHIQTTTAATTVSARVS
VEACAVLCIHSATCKAFAAGNAARRGECFLYTVNSSDVSASQVIMHPAHQLDLYEQDLSS
PACTAGTVSPSAREECTPCARGTFSTQFPRYSCNLCPSGTFTSTTGAATKDKCKPLTCPA
ASRGPDDKTKQPPSIDAVLSPAPNARLYYGTRANITWAASNGVSNVNIRLYQEYALFPGY
LGLVATIVNPHPNTGVYTWTVPSNLAAASNYYVVIFHNAKDDDASAPTYRYTGPFFIGPA
PTGPCPSGEHNPVTGENPCTLCPIGTYWVDAHTCSKCPNGTTTANNGAQSVADCSVSAND
ALAAFTKLSNMYIKESNQGGEFLEDADHMTVEECARRCLDDAGCKSFDAGAVSDFQEGDC
FLSYDNPDTAAPSRVRSISQLDLYVRRDARPVLDRRFTKVANAYLRDHDDGGLFFQENSP
EACAQLCLNDVCCKSFDAGQLGTTKEYDCYLSYDNRQSAPGAFVTDASQHLDYYEKKIDL
QLRFDALYDDLITSDNYKRSFESQVALAITNLNSVDDDAAVAVSISSTSTAETDAGGKSG
YITADVMFLDDAIKDATVKEIEDKTLQVQFPPLFGDVYTARFGKHDGPCADGTISASGDR
VDECTTCRAGTYTNLAQTICLHCPDGTTSTPGSTNAKQCTPVDAGDASSGLFAVGDEWVG
HFSASCKTSSGGTTPCTGRVSFEVVSASGSSVRLYATFTHGQYCNEAAGCREESAGVSEF
YYTAHVSSNHFSATFVPGTGGWGGITDRTFVRENIDATLQHTDDQHIEMTGSYGDGGSVR
LQKQCSAEYEPTTFNTGDAWLGTYHCTPRTVGDMKAAEGVEDVRRMELLIESVDPSTGAI
TAIVDFDHYAGIGQYKTTATFDSETTCFAVEFTPTKDAWITMHPLDVHAHQLTGKLSDSG
ELFSGQLNENPNCACNGQVSDELSQRGGSCDAWDGDGNKWCYVDATCPSATVDSDFPALH
RAPCGLFPDCTDFYLTRICAVEQPACEHGFTRINNRCYKVATTASTAGSSPITTSFAGAV
DACSTLSDELSQRGGSCDAWDGDGNKWCYVDATCPSATVDSDFPALHRAPCGLFPDCTDF
YLTRICAVEQPACEHGFTRINNRCYKVATTASTAGNSPITTSFAGAVDACSVDNATVVSL
HSLPETENVVQLLRDAGVTSAWIGLRTTENGDVAGGVDYMWVDGTPFGDVNSLGTFANWA
DGQPTAQGGKDGCAYLDLTKNAATASNSTGDDKRAAGLWYDDGVCTAQRAVVCKKLSPIV
TPSCACTGQTNSDGDGGACGTWCYVSQYCPRAVEDQGNEGLFWAICPRHFQTSTTTAMPA
SSTAPPESTTGGTTTTAAPTCHEMDPSTYTRDDGTCAQCTTTDDCDTNQVLLGECGMFTT
PVCVACDSTCAACSALGADKCTSCADGYVWSLDGKRCVSSCPLGQFADTSAGQCKMCHDT
CATCDGTADNACLSCAPASNLFLQPNDNSGGGGGDMSPARGVCVAECNRGFFANQSRSED
EYETAAPTPTSNRVCRMLTPCKAGEYELKAPTTTTDRKCTQCAAGTTDLDPNSINACTTC
DAGTYTPPGHVGPCPKCPAGTADDDSDPSTPCAACMLGQTYAAAEGSLSCSRVDMCAPGE
EEALRPTTTRNRVCVACTMGTFNAIGGNGTRCVPWTTCGAGMQPSNDAPPSASQDRMCVP
CATDEDTGAALAFKPTEGNFACSRVKLCAPGTQEMQRPTATSDRVCGRCPLGTFSPGINT
ACRKWKTCDADAFIAARGNATHDNTCQAATVCDAEMEWEQESLGQYADRVCAPLTQCKYD
DATAPEFEQMPPTKVNGVYVSDRECAACRLSCPDNQTPTRECTRTSDTRCANCTECLPHQ
YVVMECTTEDDTKCGNCTVCGDGQYQKTPCSHTLDTVCDDIHDCPSGSYQVHPPTPVSDR
VCAGLTTCGEYEVVAMEPTPTSDRVCESCDGTSEYFKEGECVAVTECPPGMITLADPTPS
TDRTCTRCPNKHFKATAGQEECQPWTDCVVGEVVTTAPTATSDRVCQLCDPTYNQYSSNP
TATQCENATVCEPGTYVDVPLTSTRDRKCKPCPSGTFSNEANMASCTPVQPCSVGSGLVT
AATPSTDRVCAPCSPPHTFSSTPTLEACAPVSDCAPGYEEDTPPTLTTDRTCTPCEATVT
FKAESGQAACQSVSACPAGQEEDIPPTTSSDRVCKPCGDGTFKAGEAGMCQPHRGVCQPG
THEVTSPTTSTDRSCESCLVENSEYQDEQDKSTCKVLTTCRPGSYVSVMPLPAQNRECTA
CPAGSYSDTENAAQCTPCGEGEYQDARSSVKCQPARVCGVGEFVSAPATSSSDTQCGRCD
GTTEFQNEPDQTSCKPVRVCGSLEEQVVPPTAVSDRVCQCKLGVGYVDNGATACTPVSVC
QSGHVEFLPATRTSDRVCVMRGSAGSLQVQFRADFSILQNAEEEATFLQLLFSALRNTTL
SARGGVPAGSDDVYFKGVLSAGSILADVGVSNGSLVPMLQGAVESGHVAFWWRAKQQRFV
AVLAGPCPPGYISPSGSRPNCTACPANTHANDAATVCTPCPDGWTSPEGSADANDCQPPV
TVSPTPTTTPQGGTRSPEKSSNTAAGNTGLIVGIVALILRRRRAHVLQPPRKSRDGQQSA
FHNPLYEDPTSLTRGGDADTGYDNVPGFGEGDGGYDHVPDIGPALSNPTYDTALFASADP
PYDTLDAALDEDDDMQHVHGYLDVVGLQDQPQHDDHDGDYKLDLNESDVDA
Download sequence
Identical sequences PTSG_06646T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]