SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_06650T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_06650T0
Domain Number 1 Region: 1-170,1062-1159
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.09e-45
Family ABC transporter ATPase domain-like 0.00017
Further Details:      
 
Domain Number 2 Region: 476-683
Classification Level Classification E-value
Superfamily Smc hinge domain 4.18e-44
Family Smc hinge domain 0.00047
Further Details:      
 
Weak hits

Sequence:  PTSG_06650T0
Domain Number - Region: 285-505
Classification Level Classification E-value
Superfamily Tropomyosin 0.0085
Family Tropomyosin 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_06650T0
Sequence length 1212
Comment | PTSG_06650 | Salpingoeca rosetta SMC2 protein (1213 aa)
Sequence
MFISEIIIDGFKSYAQRTVVSDFDPFFNAITGLNGSGKSNILDAICFVLGISNLSQVRAS
TLQELIYKQGQAGVTKATVSIVFNNEDKDQSPIGYEQHDTITVTRQIAIGGKNKYMINGH
NAQQSRVANLFQSVQLNVNNPHFLIMQGRITKVLNMKPPEILSMIEEAAGTRMFESKKTA
ALKTMTKKDKKVQEIQTLLDEDITPTLEKLRKERTSYLEFQKTKAEIDLLTRFLVAWSYQ
RAEQTLSASTDALTTAEERVKELRTQVRTLEGDRDNTQQNISLQQKRRDAEMNSALRTME
EQVGNLSKVVVKAKAEYDNKVHAIEEEEAARKAHLAQIEETQKSLEDKAGEIDAARAAVE
SGQTALQAAQDGVAESEKRCMAASVGASSDGTSLTFAEQIKELQSVISTASTQMKQAEMT
ISHATSELKTKKPNAKKSESEYKRLQRDVNALETDLKAIEEHVAKLAFDEGEEAKLHEQK
QALDREYLAAKDQVDTLSARLSRLTFEYKDPEPGFDRSQVHGLVAELIDVADASTGTALE
ITAGGKLYNVVVKDEVVGKKLLSKGQLKRRVTIIPLNKIAARSLKDDVVRRAKQEVGEEN
VDVALSLIGYPAEVAAAMEYVFGRTLVCRTLDMAKKVTFHDKIRARTVTLDGDVFDPSGT
LTGGAKASSSGVLLALQSLSKARRHLTRVETELSRVNKALAAASDAAARYQRLISNRDMK
ASELEVLRVKLDSNVHYKAVSEVKELEETIASSKEQLTASKKQKQDAEKKIKQLEKEQAS
YADKRDEQMRKAEEMRAAAKEALKAAKAEVQRLQQAHEEQVLERDALAGELKTMQRQTDK
FAETLEKLAQEKETLAATLASKKRDFEQADDQLTRKKEKLTAVDAKLRELKTHLKEVQAE
LDANALELKKLSHDKDKLAREKKEAAATVMALVRQHEWIESEKQYFGQKDTAFEFREGDP
NRDPSLCKKRLAQLQASQDKLSKNVNMKVMAMFDKAEKEYNDLIKKKQIVEQDKSKIEQA
IEELDQKKNEALRKAYVQVNDRFGSIFSTLLPGTQAKLVPAEGGDVLSGLEVKVAFGQVW
KESLTELSGGQRSLVALSLILSLLLFKPAPLYILDEVDAALDLSHTQNIGQMLRMHFKKS
QFVVVSLKDGMFNNANVLFKTKFIDGVSTVRRFAQAPSATEKENSSGRKAANTSKKPKRA
AKVPAALAAQRS
Download sequence
Identical sequences F2UFL3
PTSG_06650T0 XP_004992038.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]