SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_06655T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_06655T0
Domain Number 1 Region: 1313-1438
Classification Level Classification E-value
Superfamily CalX-like 2.88e-32
Family CalX-beta domain 0.00076
Further Details:      
 
Domain Number 2 Region: 2593-2699
Classification Level Classification E-value
Superfamily CalX-like 7.72e-27
Family CalX-beta domain 0.00046
Further Details:      
 
Domain Number 3 Region: 3491-3594
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-24
Family Cadherin 0.0013
Further Details:      
 
Domain Number 4 Region: 2471-2592
Classification Level Classification E-value
Superfamily CalX-like 2.22e-23
Family CalX-beta domain 0.0017
Further Details:      
 
Domain Number 5 Region: 1447-1558
Classification Level Classification E-value
Superfamily CalX-like 3.01e-23
Family CalX-beta domain 0.0014
Further Details:      
 
Domain Number 6 Region: 171-303
Classification Level Classification E-value
Superfamily CalX-like 6.67e-23
Family CalX-beta domain 0.0067
Further Details:      
 
Domain Number 7 Region: 1561-1703
Classification Level Classification E-value
Superfamily CalX-like 1.44e-22
Family CalX-beta domain 0.002
Further Details:      
 
Domain Number 8 Region: 813-958
Classification Level Classification E-value
Superfamily CalX-like 7.06e-21
Family CalX-beta domain 0.011
Further Details:      
 
Domain Number 9 Region: 4137-4251
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-20
Family Cadherin 0.0011
Further Details:      
 
Domain Number 10 Region: 1943-2057
Classification Level Classification E-value
Superfamily CalX-like 1.83e-20
Family CalX-beta domain 0.00095
Further Details:      
 
Domain Number 11 Region: 670-785
Classification Level Classification E-value
Superfamily CalX-like 2.09e-20
Family CalX-beta domain 0.00095
Further Details:      
 
Domain Number 12 Region: 3704-3813
Classification Level Classification E-value
Superfamily Cadherin-like 5.85e-20
Family Cadherin 0.0014
Further Details:      
 
Domain Number 13 Region: 1202-1323
Classification Level Classification E-value
Superfamily CalX-like 1.14e-19
Family CalX-beta domain 0.0039
Further Details:      
 
Domain Number 14 Region: 1055-1200
Classification Level Classification E-value
Superfamily CalX-like 7.19e-19
Family CalX-beta domain 0.0027
Further Details:      
 
Domain Number 15 Region: 313-447
Classification Level Classification E-value
Superfamily CalX-like 4.27e-18
Family CalX-beta domain 0.0045
Further Details:      
 
Domain Number 16 Region: 1832-1954
Classification Level Classification E-value
Superfamily CalX-like 2.88e-17
Family CalX-beta domain 0.0066
Further Details:      
 
Domain Number 17 Region: 549-680
Classification Level Classification E-value
Superfamily CalX-like 7.32e-17
Family CalX-beta domain 0.0052
Further Details:      
 
Domain Number 18 Region: 2216-2382
Classification Level Classification E-value
Superfamily CalX-like 4.19e-16
Family CalX-beta domain 0.0026
Further Details:      
 
Domain Number 19 Region: 2364-2483
Classification Level Classification E-value
Superfamily CalX-like 8.76e-16
Family CalX-beta domain 0.0042
Further Details:      
 
Domain Number 20 Region: 3129-3242
Classification Level Classification E-value
Superfamily CalX-like 0.00000000000000113
Family CalX-beta domain 0.0028
Further Details:      
 
Domain Number 21 Region: 4045-4142
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000003
Family Cadherin 0.0027
Further Details:      
 
Domain Number 22 Region: 2087-2199
Classification Level Classification E-value
Superfamily CalX-like 0.00000000000000549
Family CalX-beta domain 0.0049
Further Details:      
 
Domain Number 23 Region: 3818-3923
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000957
Family Cadherin 0.0032
Further Details:      
 
Domain Number 24 Region: 3386-3498
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000214
Family Cadherin 0.0029
Further Details:      
 
Domain Number 25 Region: 3923-4040
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000257
Family Cadherin 0.0042
Further Details:      
 
Domain Number 26 Region: 918-1051
Classification Level Classification E-value
Superfamily CalX-like 0.00000000000314
Family CalX-beta domain 0.0052
Further Details:      
 
Domain Number 27 Region: 3605-3711
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000257
Family Cadherin 0.0058
Further Details:      
 
Domain Number 28 Region: 3281-3319
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000012
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 29 Region: 3245-3287
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000457
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_06655T0
Sequence length 7004
Comment | PTSG_06655 | Salpingoeca rosetta NOTCH2 (7005 aa)
Sequence
MAPVSVHPPQHSHALRWLSTLLLVLGVFSSLLTTAAGSAIVLANNFGTCGIEPSLAIGKC
GAVHVSLDSWELQLQAPADLECKFYHDSDCSQVVSSGLSPDIWSTPSSSILARTNVGKGR
MPVYLRCVGTQTGTEVVLKNTWNGISTINEEESLLVVENHIACDPDPDRVVFSLSASATS
VVEEDTPSITFNVSRTGPTDDDVSVRLAAVDFQASRNADYTRASASRLITFAAGQTWAQE
TIPILDDAFPELAESFALALTQPTLLTGSGREVVLEDGAAVVLITIQPSDDPHGVIALRN
PNTTIALTEPLSGATTITIPLVRTGGTFGSVTVDWIIDGDAQTHDFDALQGSVTFGSAEA
AANITLQLRADNQPELLEQSVFRLLTASNGATVDAASAALTLTVDPNDDPHGVVYVQASE
QQLIMHHTGQRALRILAQRSAGTQGAVNVTFSVTFGTSNIISNNLACLQQFIIADSVTIA
ISHGAASAEAVLPFSDTVLLEQGAGFCLQATAVALADGSPVLVASDSLSPRLNTSRVDAR
VVVARAFANGVVGFAGTSINQAEPATQQQDITILLVRSGGGYGTLDVQLSLTGNSEYAVP
GQDVTLSSNVSHFDAGDSLHELTVSVHPDNIPELAEQFFVTVADIPSGRAAIDSDSSVLT
VTVPKNDDANGVLGFEVTGYRVSETDPSGHVVLNVTRTRGAFQSVSVAFATSDGTAVAGT
NYEAQSGTLVFGEGERSKEIAVGVLDAGAPRAPVRTLTVTLGQVIGGARVAAASATATVN
IQSCHHCSFNIIDSPSPLVTAEPAGTNTADVTEVAIPVRRTPDTFGPATLHWTVFENDPA
TGDITAVQASMDFVDATGAVSFVHGQQDAVVVLHIRNDNEPELTERFSLVLVSVDGDPSL
GINATLPIDIVANDLCFGSFSFSAYPAAVTVYEPQDPSSGARVHTFNITRARGTFNSVRV
SLELQLLTAGDSAATSDDAVLLTPSVVFAEGQTSALARVSVTNDNIPEIAESIILRAASV
AVLNTNETVTSDLVTIDDTDDYIELVIAENDDARGVVSIRPLALTASEGGAPSDVQFTLT
RTRGVFGVVTVTAGLVSVASGTAGVNASNVATLSGPEQDAFLPMPTVTFVEGQTEAMLSV
GVVDDDLPEVDEQLRVVLVNTTGGLVVGANDTAVLTIAASDAAFGDLSITNASTLAVLHE
LEGEDAMYELEVLRGGGDFGTITVEWHLEVVTPGDGGTTSSPLVLGSDISPSSGTLTFAP
GQRRAVVALTVYADNMPETNEEALLVLSSPTNGAQLQANATSRRVVIEANQEPHGVVSLA
DATIIVDEGAGTVSVAVTRESGAIGQISVDVTVRGVSAAGGGVDFAATNTTLVFAPGVRQ
LAHPITIIDDDIPELDETLVVSLSNPTGGALLGAITQTEITIFNNDDAFGLVRVANTTPA
DVAAFDESAADSSIVFTIVRDAGAFTSISVPWSLQQVAGSSAATPDFDVTAGVVQFAEGE
RVATITVHVLDDDVPEDDETYQLVLSSVTGSARAHPQLGRHNVTIAWNDNAFGIISVQAG
ARSQRVAESDGSVSIPLQRTQGTFRRVGVNWVIAVATVSSGDVSPTSGTAYFEPGSDTAA
IVISITDDAIPEVDEGFTVSLQSVTVAGALLVSDLNALRADVTIVANDDPHGVISLRSGS
GTLALTSGGLRSLRVTLDRSGGTILPIDITFSVLMSLPPGGVQASSGSGGGTAERSPCQA
QTIVSSPQTVTMGDKLASRVVSLLIEETAVLVQDAVFCIQLDSVVLSRDGSHTNTSTGPS
PSLAASMDARALNVSVSSAYANGLVAFGDTAGTVHVTEAADLDAPETQLVPVVRSDGSFG
DVALAWEIVPSHTGDFDAVSGTVMLPSGQSFASIPITAVKEQVPELDELFQLRLTGITSG
TATLGAGVNDTRVQLLIPANDDPFGVLGFEVTGYRVSETDPSGHVVLNVTRTRGAFQSVS
VAFATSDGTAVAGTNYEAQSGTLVFGEGERSKEIAVGVLDAGAPRAPVRTLTVTLGQVIG
GARVAAASATVTVNIQSCHHCSVFLDPTQDLFVGEEPASPDPADATGIDVRVLRQPDSYG
SALVGWRVVHAGTNTLASDDFVDANGTVTLEHGETETTLRLLPRADATPETAEAFEVELT
SVSGDPSLGSDDVLEPVTRNVQLEPSDQPYGLFRIGTAYVRDGNSGAVNSVAGTADSVST
QEGDTVQVTIDRQHGTLGAVDVYLMLLSLAGEVPADNAATPGDDIAILHSAGIGAVRFAD
GQTRANATLAIIDDGLPELDERLVVALLNATIVGDTLAASMDARRVRVSNTTRESGLTIA
VEENDDAHGVFELSAPSLANETLSEGAVATVTVERRRGTFGAAGVSLVLSSVVDDDNTAT
TDAVLSQTDITFVEGESSVQVTLTVLDDAVPEDTESFVLSLSAGSVTGGARLSPNAWATQ
AAFSVAPNDDPFGVFTLAQPLYSVDEPANVTVTVLRSAGLYRTVSIPWQVNQNATSPDVA
PSSGVVVFVPGQTEAYVQLTVIDDSIPEDREDVVFTLQAPTSPVARIERNTTTIRIAAND
FVNGVLEFEPGLSVLRVGEDVGLFSITVRRRGGTQGTVSAAYETLDLTATRSSNDYAYAQ
GRVEFAPGETEQTISLIVVDDDVPEDDERFLLVLSDAQGGAVLGLSSQLEAEVAASERAN
AAAVAAADLVTLREMQVTNLSANITALEAKLDRLADAIASNETSADAVAADLASARALLA
EENANLTAAQTLAQQRQASLQAASSVLDSALATRTSIAEQLDDATTALNSVVRRVVDFTQ
EPDTIDLAAQLPAPESEIEYYAGLVVTAVYYTQPDSPTPRSIAVREGLGFGVVGSACGGT
CFTGLHEVRLAFNTTVSNVVFENSFTDSEEPLGPLAVTIYNLDGTAIDTAMMQRDAVFNN
AYNISAAFPGVRIGGFAVQATDSIVRFASVSFDQVEGGSYEDALARVNTYSSQLSAADVA
VFDAQQQAGLAAQAYVQAAAALSQQSAETAAAQQQEQTLSQQASALNATLLMLRTDSRQT
QSLLNSQRQRYADHTLLLQQAENELIQAQEQADQLAAAVTEAQQAAVCPDLQCVSSITVE
IAHNDDAFGVFSINATAAVASATAGEGQAFVVPVVRAAGTFRAVSLQWRLNFSSTASPAD
IAAPTTGALTFSSRQTSAELVLPIVDDAVTEEAEHLSVILTNVSLGRVEDPSSLTLTIDA
SDAVGICTPTSCANNATCVDGVFDVTCLCQPGFAGDRCDININECANVTCFNGGTCADRI
NDFDCACINGFQGKLCEISPLCDQGETWCFRSNACVHTAISQQTCQVPCDSETHVFCFAS
QTCRPRVVADMPCPVPGPAPLITAPFAISVAEDTAVLTSLASVYATPRHRWGENITYFIE
DVGMGGGAAGDVANTTVAGPFAIDTLTGVISLVGLLDREQVDAYTLLVTAVDSAPDHKTN
STTVTVVVTDVNDNSPTFAPATPTAVSVLESASVGTQVAQLVASDPDAGANGNVRFTLDA
GNALGSFQLDSSSGVLSVAGTLDGDQQTSYTLTISAHDQGTPPLTTTTTLEVNVVVYPPP
AFTDGGSYTAGFPEEATGLVVRVSATVQHPYSNDAVMYAVVSAETSEGDDVTSHVGVNST
GHIHATQALDRESYAFVVVTVAATDFAPLRKTSLAVVNVTVVDVNDNAPVFDSSVADGVL
VFVREEDAPGTLVTDELTAQDADQGDNARITYSIVSGNTGNAFSIDADTGVVTLAAQLNG
SVVDEYVLGVEARDNAAHVSDQLSSVVSVNVSVVYFGAPVFGAPSYRGNVSEDAGVGTGV
VRVCATAQHDGADQGIDFAIVSGNVGGVFGLRMGSDNVSAEVYVAGPLDRETRGVYVLGV
VGRDRGPLRKRSGVGVRVDVLDVNDHVPVVVGADGGESGGWPEPVVRMEVREEASVGSVV
GVIVSEDGDAGAYGTVTVSVGATRVGGGDFGGVFSLDGGSGRVLVAGVLDGAETPEYVVE
VIARDGGGLTSNATLIITVIYFNGPRFNATSYAATAAEDVVVGATIVNVFAVARHDQLDR
TIDYSLADSLGLFDVTADGRIVAAAPLDYETATLHELTVVATDHGPLRKSSNVTVVVTVT
DVNDNAPEFSPPSYTFTIREDASEGVVVGSVNAFDLDSGANAALHFSTDSPAFAVASPSS
SGVTTVDVVVTAYGAVTLDGLQEPTITLTVTARDGGSPALSSTATVTIDVTLVPTVQAPY
LKLYNTLSAASGFIPAEFSRDVSSLALVSDFDTRHGVWDISVDDGSTWTRVNTGARWRDN
TALVLRTGESSSTLLRFVPTEGFAGVATVHVRAYNGDNATITGAAAGAAADALVDVGASP
DTLHDVSGNTALGVVFVAAPLSSVQVAESTNVTVDLPNLLEDTSLLQNVGVQLTSLLQGH
LQFATVSGPATGMAALTTGGCDGTGTWCNSTAVAVMFPDDVDTLVQPRDHGIVVESVSES
AGVWQSRAASVTGFEETLVGDVVPLQSLLRFVPAAEENGLFEMVVRGWHGKLHALARQAS
TTAHTITIRQSVVAVADAPRALTANVTLAPVPYEVTAQTANGSRVDESIAGHAVDADGQA
IGLAVVGVANCITTTATATSSSNGDRCRGSWQYLLDSTQEWRAFPLDASDQKAVLLAPHS
RVRFVPLPNYFWPRGNASVWLRVRYWDMSVGRAGDTAMLADASAPQQLLFPTAFSSRVVS
VFVDRLGCDGEVGSQLSVDACGVCGGNGSACAGCDGVLASNVQEDACGECGGDGSSCMGC
DLVPLSNAQVDECGICGGQNLNKDCAGVCFGVASRDDCGACFGGDAERQTPDLDKDCDGV
CFGAAFVDDCGACVEGATGLSANYNKDCAGVCFGGAQISDVCALQGVSYCGEPVLDCSGE
CFGSRIVSSCGDCVQPDNATLLDCAGVSGVTPRVVPVSSASVRFTIAGSGFPPDVGARDV
TCRAVSSSGRGSVTGYGWVASSTTITCVFSTLTVGDYDLEVELHGSALSSSPSSSSSSSL
AVAVVSDAASVGAPPTTNVNAFPYDTQTFNLFAVTPSSAPLANLSEAVDAIRVSGALSSF
GPADETTGCLFVTSDTGLLGVVSGQWFARRINCVAGPLQFARQIEIDIEDDEQQAFTTLD
AVESHLRQARPDIASVTFTVSGDGDAASGKPLPTGSSVLVEFSADLNQIACLEASMATIN
ALFGLFPRVSSGSAGSAADADANAVPTLVGSDVLSLSSSEVVCAVPSVQRSATMEVMLVH
QGVVAAASGTTPTVTFVHRAAQASARFSASGRHLVVTFDVGVLPVEPCAAVFTAASRSAL
DATACTWTTHTLTVSLGRNATLLPGDRVWFAPVDTSGDVAADTLSTGAGIHVAGELHSYA
VSGSVVVGLPDDYQPSIPRFTLPQQVRACAGLLLDASASHVAAGRPATFHWSALAHGGED
TTALEAHLASVSGSSDGPEGVVVEVASSLLRAGTTYTFGLAIEDALGVRSSVVTVDTTVM
VQGSVGGGAQQVASLEILGIPPVLHASSDLTVRVRPVAPLHGNTCAGESLGTAIAAALGA
ASGTSADVQYCWQLSPARASNGGAPLAVASACAPTPWFTVSGTLLLPHQQHTLTVTVRVT
SEDAEAPVLASTSTVFDVVPTPLEASVLGGDLLGGRRTVPLDATISLDASVSSDPDATDE
LELFGWRCEDIALSQPCSTTANGNVPSVLLFPATPQLSQAAADFGAGSYRFTATYRKGGR
FVDARAVVEVVEAPVAPQLRVFGVAQGYVPTPTEHVFLPHAVVNPSLPVTVVVEVTHASA
LASATWSVVADSSSGSGGNEDEEPLAWLDLEATALTPLTYTQAELAALVTLDDGTQRTFL
QLTLPPDAVVSGATYRFRCTAATAAEHGFAEATVVGNHVPSGGALDVVSWTMTNNGMGVT
RARLTAQGWGDADLHYPLMYRFGVGADPATRVWLTTFDYSSRLSGVVLPAPASNTTTHVS
VVLQVRDRLGATAESTVEVATSTATTAGTGTTPSVDAAALAANVSAALDAGNWPLAVRVG
VEALWMTGDSTNAAVVVDTVAGVVLDSVRAALSLQSGSSSSSSSASLTDGEADLLLSAVA
VVANRRAFLSETTRGRVGELTEHIGAILIPAAEEEGLLNSNNNNSNSNSNSNRRRRASGA
VDGGYGSSSSVTPQQGLAMTDIYSSAIALDSFTATNAALKARLNTLLQVIARVECRRLSF
KARPYQLENDLFHLEVAVLSGASVQTVDTTQLDYGSDFEARFERWACDDPAPASRCAGVC
SAAVLFNADMTTAFQDEPAFRRASPLLDMRFYDQTSLHTVQVASLDPALSLFLPITEAAP
AGTTDSSPQRRRRSSSSSSSSDDVAAHDRVNTPHVVTSSNVDSNSSSNGASRDGSDAVRV
RREGPSVSAPEFECLVYDASQHLWLADSRCSYFAPNTGEQGVDQLECRCTAGNLQVAGYY
YASSTTGEVNVTVPAAPSGDVLAYHLRAYTYETETNAESAAWLTGFVGTFYQSMVQLLSL
QDSQVAGVEVVSVINGTGNRQTLVVDFYLVEPDGNGGNATVLDGYVEDLNTLIDTRQARF
VYDSTTFELYNVTMVSGGGNTGGSGSSGSLGSGFWVGIAFAIAAALAMLVALVLLLQGRI
GGREGKAKLGGKSVDDESTLEMVDLGRRSLAASSNTSRRSSVAQLLPRFMRRTSSVVMPE
QLVEVDEEGEEDEGAQLTGDDARDQVAQTASTRLAWTRRSSLSTMATATTAATGAGDGDG
EHQVSGGAASTPATTPARRLSVASATSPQVDETEFSKGGSSDRTGGGDDDDDGASGTHGA
ALPFSPRSSASLGGDGQQQQQQQQQQRQRQDPLAPLTSTTTPPRGMPPRVPRLPSSSSSS
SSLSAAPGGTVPAPSALTLRPALRVPSLRSRQGPGGSEPSTPGTLPQLRPGIRAPQSLPR
LQPRALPRVNRPPPPRRPSQQQQQRTVVAPIPEESDADANESQA
Download sequence
Identical sequences F2UFL8
XP_004992043.1.12839 PTSG_06655T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]