SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_06676T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_06676T0
Domain Number 1 Region: 92-285
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.0000000173
Family beta-glycanases 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_06676T0
Sequence length 323
Comment | PTSG_06676 | Salpingoeca rosetta predicted protein (324 aa)
Sequence
MARVQWCGRSMAVIALLLTMPWMAKPVAAGQGKLSIHTSFDPGTESWEFIKAVKPPVVKL
LDNFGPAAQIKQVSPSTLIVGRIYLPNQPQSGDPTQAAQAWFNDHKGTITANPAVDYWEG
YNEPGAGTLQDMQWIGQFEAARVKLLAGIGAKASVGNFGTGSPDVTQADHINAFNPAIDA
AIQHNGILGLHEYNSPILANCFDNSTGEGWMTGRYRKYYRQFLIPSNRTLPLVVSEFGID
NSPCTQPASPNFGGWRKYCSWWSAHGHGSDCAQTYVNMMLWYDALLRQDSYVLGATIYQL
EIPGWQDYSIAGNVTTLLTQVLR
Download sequence
Identical sequences F2UFP1
PTSG_06676T0 XP_004992066.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]