SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_06708T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PTSG_06708T0
Domain Number - Region: 316-373
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0213
Family Family 30 carbohydrate binding module, CBM30 (PKD repeat) 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_06708T0
Sequence length 399
Comment | PTSG_06708 | Salpingoeca rosetta predicted protein (400 aa)
Sequence
MLLTLLGMLANMVRALHTKTVRVSHRLTCISDGTERPLVGKSTCFHRLDVATLHWHGNLA
AIRSSRPQPFGNTGSGQPRHQPEAFSPVSSPSSPLSSSSPASPSSFSPTSSSAESPAEPS
SPTWSSAQHMTFHPVPTPLLPRRTYADAARNGRAQNGHATATHSGVVGKPEKEQQQQQQQ
QQQVQQIPPYGTATAFTPYAGSRGAGGDGDDGHVLVGFCQVTQELGADSVPSRAWGVCFT
ARASALNLVFAVIVHVDESHLQAYRRQKQREVQQELARLQRTPGRRRSSARTRRQPLSGR
TRTSVGSIGNEARTRNTEGTIAYVAYFRPTTEFDSYCLRFSDFTANQRGRHLPDAPALKA
SAITRIGFSITRSTQTIEAEEGDVTPFDLYMKPAWHFVI
Download sequence
Identical sequences F2UEK1
XP_004992104.1.12839 PTSG_06708T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]