SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_06729T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_06729T0
Domain Number 1 Region: 2181-2344
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.72e-21
Family Laminin G-like module 0.0032
Further Details:      
 
Domain Number 2 Region: 2597-2757
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000132
Family Laminin G-like module 0.0045
Further Details:      
 
Domain Number 3 Region: 1818-1860,1916-1969,2102-2147
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000278
Family Growth factor receptor domain 0.0058
Further Details:      
 
Domain Number 4 Region: 2335-2378
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000191
Family EGF-type module 0.013
Further Details:      
 
Domain Number 5 Region: 2397-2570
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000155
Family Laminin G-like module 0.031
Further Details:      
 
Weak hits

Sequence:  PTSG_06729T0
Domain Number - Region: 1228-1294
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.02
Family Type I dockerin domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_06729T0
Sequence length 2902
Comment | PTSG_06729 | Salpingoeca rosetta notch (2903 aa)
Sequence
MSFKQAYGQQATAQPLSDPIITPVTTTSTTTTTTTTSSSTFAFGSVDLLVSTEVTGAGRL
LAQPFDGSSSSSSPLATVSSPINVAPGASGQVSMRVGKETVSAAYRSGAAALAAVRVQAV
ERDVYSTYGTIRFATQARDALGGPHAAPTAVEVCLFLDGTMPVPTPSMCTTCTTAPASAA
TCTGWIDVPATVFAAIAAGDVGEPAHLVATIGTLTATDEVEQLTVLGDSWSGDSVIDTMA
RTAAVAGLLTPDALDAGVEVRQAPLFEMQLSVRAGASASSASDVVVEAVELADSMGRPLQ
VNGEDVPVPITLRDRVSSSALGTVFVAANTPTVHLPQLATHQTLSRSELDMPVQRVAVQH
WTARPFPRSTPPPLVVASTSSSPSLADLGLECTSITADGLSVAQSCAEVMVTRGTRAPGA
AVAVMSTATGRATLLNMTITYPQFPLTIAVDNPTLRAIQGLKQRTSDGSGTCVPVYQQTP
FAIRDDTYDYTSMLAPWLQVTNPNVVRVDRERFTLTGTAPGQATLVLQNTFGDLLATVSI
EVSTAQVSALSVDAAAYQPANVSLRLSNDELAQNGDAIVATLHAPLRPVLTRLGAQARVL
ATVQLSDGTSWFLYDSTFLTVTPASADTGLTVNGTDVTLAGFAAPQEGPLLRVALSPECG
TPLPPDAVMTAFADVVLALPDAVSAELVLDATRLATVGSTAALAGVPATSAITVYVTFSD
GTVLDLTASPHVNITVEPPQNLRFTRDGDTGRLMVTPTSVGEVQLQASFAAAGVRVTSQA
VVVTVVSATQLTATPRPFPTYAGSGAVEKTTLFELGATQQYQQAAITAWLSMSDGSTLDV
SQHSSLDVSVTPNPPDLEGAFVVQRTPITVITPTQGGFFMDVDVGFGSLSSTVSVFVSTS
SVQVTSITNLRLLSGPLLAGRAGAASTRAQMRVVFGDGTVMPSFVPAEGPLVPGLITLSV
SDTDAASVSSATGQVVLLGNSGASGVTLLATTAQGSGSAQASYAFATNLVPELGDVDLGP
TTTNPSPTLVVGEARSLQLRVNVQGRRFGGFELELLLDDAIVDVEAITPAYAGGAFAWVR
RTNRAVLSGVLDVQGTSSLALASVRLRGVALGASPLQVRVVSLGEGDGVGTPIGEPTPRL
ATAANISVDVVTGTGRRRRQVDWPVVDTDDASASAADTLAAVALEHDTSAKTAVHVRTRR
STCTPAQFVLLGDGSGCTEVVPCPSTSRVVGDVNGDCAFNVNDAAFALAYLLESTISFES
ERGQRFLSYVRQFPEVVDTLDFNRDTALSVHDVLYANLANLGVVRLIAGIEVSAVCSMGC
TLEVSVDARTRAGDGGVDDTIFIADIAFAAPDVALVGNVTVGSLVTANKGTGLNGVLLRM
NQDASVYTAVVAVQTEAPVLAGLSLIQITPDLARRPALRPSMFLDGRDVSPYAYVGQFSA
AVPAFGEDSAVTIAADGDHNINVFINFDLVIIVLFHFVIQHNHNHNNLDHHHCVFNINVI
VFDNIIVDFDVHIHLNRQWNAAHFDFHHRHDDDNNNNNNNNNNNNNNNNDDDDDDDDDDD
DNNNNDDDDDDDNNNNNNNNNNNNNDDNTNNNDDDDDDDDDDDDDYSVFDINLLVFFLLD
INININVNVNRQWSGIDLHIFYDNEHDDNDDDDVNIVLVDLNVHGNINDGKWYGASNNVA
YFLDAAESGNGIWQDIALFYTEGDLVTFTAAVFRPNDIPISSTLNLELRLASGAVLAARP
VFAQEVPSGGWAYFSVSLLPGAGASWLGQQVRIGVSFDGSGLTLGIDDASAYSRVVDTCM
AKMTTGGEPCLCNPLANCHVCTLGLDDVSGQLYGLECMTCKNGRFLLGGVCVDACPEGYV
AAGAGQFNRRCVVPTTAVSTTAPTTATTTQAPVVDTCMAKTTTGGEPCLCNPLANCHVCT
LGLDDVSGQLYGLECMTCKNGRFLLGGVCVDACPEGYVAAGAGQFNRRCVVPTTTDDATQ
VQLAFDSLDFAYLQSPADRAAFIAALTAALEAEGVDTNALCDTSLMSGSVLVTIVVPDSL
LDVLRQAIETGRVNVTLGGVSGTAVLVPAVSQSAELCSAKRTTQGERCLCNPLRDCHVCI
LDQQDDGTSNMFAGSICTKCKNGKYLLNGECVSQCPNGTVPDGLGLFNLRCSPVVEEPNW
RLVSPDARVVFSSAPSVLQPQIVIGRTTNTLVIRMRATTNGQLFFMSNSIGNAYVSVSLV
QGAVRLAVNLGFGETALTTAPTARGFVDYQWHEIRVTRAGTTVALAVDEHPVMHGSAAAP
FAHVVRFGPLASIGSAMQAPGTAAFTGCIDRVVLDDVPLTLAQAQSIFDVAGCPTDGCSA
SPCENGATCVPTNESYFCLCPVGFTGFTCDTPQDICASLQPCNNGGVCRVVDDGDFVCDC
PISFSGPLCDTERDFSSPYSVGASGSVGVRGVSVSRDVRVNVRLGADTTDILRFTGEDGS
TLVVHVEDGAASVMFTPVGAELPLSYESSGRAFAGDEWFVLRLQRQQLTLGVTLDDTAIA
VIPITPQLAGVLTNTTLNLLLPDGCAADLRVDALPLPLLEGAFASGLEPCAATVCDPSPC
MNSALACTPVGDFDFACTCAPGFSGPRCEVRAPYEVCDEGVQFTADRLLVLDPDTRERSR
VLPDKPLALRLSFRFNEPDTSAVLFSMTAPDMTPSSSAPINYGTLRILSTGQVAFTVDYG
GAAYTAVAPMTFDDGEWHSVSIVRTMQEASLVLDDGAAVAHAVASTVTADAWESLFFSPR
VGALLGGDVGPPLHGVTQAVCARRCIDEEKCLSFDFTPSRVVAGVIQPSMCSLNGDTADR
VLGGLTPSDDTLYYELRSATSATTTTVTFGRFDSADTGMAGGSGGGSGSGAMCDACLGGL
ALNDAPTDLASLSGQSLTPCST
Download sequence
Identical sequences PTSG_06729T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]