SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_06771T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_06771T0
Domain Number 1 Region: 264-302
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000326
Family TNF receptor-like 0.0034
Further Details:      
 
Domain Number 2 Region: 223-260
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000942
Family TNF receptor-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_06771T0
Sequence length 321
Comment | PTSG_06771 | Salpingoeca rosetta predicted protein (322 aa)
Sequence
MSCRLHLTHCHYDLATCDVSAARACDGEACRVNRNHTIEIYNLMANDFNQTEFEQALVAA
ANLTGASVVQVTVREADTVCDSGTPTGFDARTDPITRSTCSQERRRRAGNETLTTIAPSN
TTMPATMASNSTTAVPATMASNSTTVPATMPSNMTTTASNTTMPSNSTAMPATTAVNATT
TTTTTTTTTTTTTMDPCTCAENQYVVEACNATQNITSATCADCSTCDAGQFVATNCRGMT
DTQCGNCTDGTFQSMTAHLEMSCKPCTDTCGSGTFLASACTRTMDTQCSACPDNTFQSAD
SHNLTSCTTCDTCTAGEFAFR
Download sequence
Identical sequences PTSG_06771T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]