SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_06835T1 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PTSG_06835T1
Domain Number - Region: 68-170
Classification Level Classification E-value
Superfamily Tropomyosin 0.00294
Family Tropomyosin 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_06835T1
Sequence length 219
Comment | PTSG_06835 | Salpingoeca rosetta hypothetical protein (220 aa)
Sequence
MAKSRSDRPGGPMVSEAGKDHVIFSKKLLLSIAVVLIVTAFLFFTVEQSRIAGNIAKSKK
ALEQNAAVKDANTKLEQAKNELQAEEDELVNLYSQWLDEDSTELELSQEQLAQLKAQLKS
VTERVSDNSAQLDAKSSTLQEKEERLAAYQFKIQQKQAFIEQLADILAQLNSSVPKKGIA
IDEQVDDLIWDDEFEADDDFAYDEFYAGDDDWLDDGTEW
Download sequence
Identical sequences F2UEY2
XP_004992235.1.12839 PTSG_06835T1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]