SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_06921T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_06921T0
Domain Number 1 Region: 118-280
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.42e-27
Family NagZ-like 0.00098
Further Details:      
 
Domain Number 2 Region: 286-347
Classification Level Classification E-value
Superfamily Beta-D-glucan exohydrolase, C-terminal domain 0.00000000000562
Family Beta-D-glucan exohydrolase, C-terminal domain 0.01
Further Details:      
 
Weak hits

Sequence:  PTSG_06921T0
Domain Number - Region: 40-84
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00051
Family Hairpin loop containing domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_06921T0
Sequence length 487
Comment | PTSG_06921 | Salpingoeca rosetta conserved hypothetical protein (488 aa)
Sequence
MRMPSHLLLAAAVVAVVAVCSGRCEGAEPGLQCKLETGVIIGAGNIDVLQVASADACCNA
CNANSACIAFTFDTSTHACFLKDNLRDNTTQSDRISGTNGRSPNDVFYACQGKFGSLRFC
NTSLPLDARLQDLISRVKLDDVGAQLRARQSPQLLDIGVPAYYWGTNAIHGMQNTQCLPD
GQCPTSFPAPCGLAATFNMSIVKEMGRIIGRELRAYYNGQFHNSLDTWSPTINPSRDPRW
GRNVESPGEDPLVCGLYGSAYTQGLQYGDDPNYYQAIVTLKVLLCVETIFGANNPGGKLP
VTMYPSTYVDDIDFLNMSMTTGPGRSYKYYTGTPLFAFGFGLSYTTFNLTWSPAPPSGVL
TSPHATKTYTCKVTNTGRVAGDEVVFAFMKPKAATITTLGSDTPVPIKVLFAFERVSLAA
GASTTVHFNLTTTMLGLVDNDGHRSVHNGDYDVELTRGHGEELLTTVTVALPAASHPHRI
STFRKWW
Download sequence
Identical sequences PTSG_06921T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]