SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_06930T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_06930T0
Domain Number 1 Region: 479-607
Classification Level Classification E-value
Superfamily C-type lectin-like 1.54e-19
Family C-type lectin domain 0.0071
Further Details:      
 
Domain Number 2 Region: 637-757
Classification Level Classification E-value
Superfamily C-type lectin-like 1.08e-18
Family C-type lectin domain 0.0038
Further Details:      
 
Weak hits

Sequence:  PTSG_06930T0
Domain Number - Region: 390-478
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0254
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_06930T0
Sequence length 758
Comment | PTSG_06930 | Salpingoeca rosetta hypothetical protein (759 aa)
Sequence
METYMHIKYSTTPKQFHLYFHVHIDVHIYLHLHVHVHIYLQLYVHLDLHLDGYVHEYFHL
TSTTTSTCTSTSTSTSTSTARSSSTGTSRLCDVHVDIHVHVHLHEYFHVHKHIYLYVDLH
LYFYFYFYFYFYLYFYFYFYFYFYFYFYVHKHVYLYVDLHIYLYFHVHIYLHLHVYVHVH
LHVHLYLHIHIHLHLHLHEYFHVHVHLHEYFHVHLHVHLDLHFHLHLYLYFYFHLHLYLY
VHLHEYFHVYFYFHVHLYLHEYFHVHVHIHFYFHLHLYLYVHLHEYFHVHLHVHLDLHLY
LHFYFHLHIYFHFHLHLYVHLHEYFHIYFHFHLHLHVHLDLHLYLHFYFHLHVYVHEYFH
VYLYFYLHVFVYLYVYLNDSGSGFVTFTSTSTSTSTSTSTSTSTSTSTSTSTSTSSSTST
STSTSTTTSSSTSTSSSTSSSSSTSSSSTTTSFTTTTTTTEALTFVDYFNEATNETEQWL
VGLSSTFFYVKDYRNQYGAEEQCQLRGGHLATISSQEELQLLMRYIFLHTRGRSVWLGAV
VNLDGSVEWQDGTEYDDSWAPWAENEPLLAELQGVRMKVWGVDDVDWFSHYQKRRLHYLC
ERDDASTSSSTVTSTTTATTTTPSVEIVNGLAQGPDSQYLYLDVPGNRDSAQVICATFSG
ALAVVGTGAEQEFVTRYLTSDSPPAFVWLGGRVDTSGTPTWDDGTPYDGSFVPWGVGEPR
SDTTSDRVITMLVTEGGNVIWTTTVDSDSRAILCEIPY
Download sequence
Identical sequences F2UF78
XP_004992331.1.12839 PTSG_06930T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]