SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_06983T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_06983T0
Domain Number 1 Region: 188-344
Classification Level Classification E-value
Superfamily C-type lectin-like 2.02e-35
Family C-type lectin domain 0.00039
Further Details:      
 
Domain Number 2 Region: 57-189
Classification Level Classification E-value
Superfamily C-type lectin-like 5.23e-34
Family C-type lectin domain 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_06983T0
Sequence length 391
Comment | PTSG_06983 | Salpingoeca rosetta salivary C-type lectin (392 aa)
Sequence
MKRGTSGCVLALAVVALLLGGGYAQSTSSAAATSTTTTRAPSEVAVDFRRPSATSVYEYG
YVRKKESFRIAEERCQLYYGGQLASIHSLAEHDFIFSLWNDRRVEVWIGGQRDTAAPSGW
SWVDGTPFDFELWMVGEPNNYRANEDCIRMGHTTQGFFGLWNDARCNQRRNYVCKRLAPQ
PTIQPPFPTSTTTTTSSVNLVPPGFILDNGFVQNPATGCYYLVYTRPRLSWFDARQECKR
LGGPSADLASVESIEENAYIDSLFDAIGATDRPRWIGGYRDLATGNFLWADGTPWAFTNW
ANGEPNNLNNGEDCVSMGFRRFGGEEWNDADCLTRRRFACKVCPPFPGATTTVAATASSQ
ATTTTTTATSTDSQTSTTFESTSTSAVVSTP
Download sequence
Identical sequences F2UFD4
XP_004992387.1.12839 PTSG_06983T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]