SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_07016T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_07016T0
Domain Number 1 Region: 3943-4068
Classification Level Classification E-value
Superfamily Cadherin-like 1.33e-25
Family Cadherin 0.00087
Further Details:      
 
Domain Number 2 Region: 3061-3181
Classification Level Classification E-value
Superfamily Cadherin-like 1.34e-24
Family Cadherin 0.00081
Further Details:      
 
Domain Number 3 Region: 5441-5564
Classification Level Classification E-value
Superfamily Cadherin-like 1.96e-24
Family Cadherin 0.0013
Further Details:      
 
Domain Number 4 Region: 5998-6101
Classification Level Classification E-value
Superfamily Cadherin-like 1.21e-23
Family Cadherin 0.0019
Further Details:      
 
Domain Number 5 Region: 3507-3635
Classification Level Classification E-value
Superfamily Cadherin-like 7.71e-23
Family Cadherin 0.0009
Further Details:      
 
Domain Number 6 Region: 6527-6655
Classification Level Classification E-value
Superfamily Cadherin-like 2e-21
Family Cadherin 0.0045
Further Details:      
 
Domain Number 7 Region: 3281-3390
Classification Level Classification E-value
Superfamily Cadherin-like 5.14e-21
Family Cadherin 0.0024
Further Details:      
 
Domain Number 8 Region: 6317-6419
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-20
Family Cadherin 0.0012
Further Details:      
 
Domain Number 9 Region: 6205-6338
Classification Level Classification E-value
Superfamily Cadherin-like 7.14e-20
Family Cadherin 0.00091
Further Details:      
 
Domain Number 10 Region: 3847-3955
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-19
Family Cadherin 0.0012
Further Details:      
 
Domain Number 11 Region: 3740-3845
Classification Level Classification E-value
Superfamily Cadherin-like 4.28e-19
Family Cadherin 0.0028
Further Details:      
 
Domain Number 12 Region: 5889-5996
Classification Level Classification E-value
Superfamily Cadherin-like 5e-19
Family Cadherin 0.0016
Further Details:      
 
Domain Number 13 Region: 5542-5667
Classification Level Classification E-value
Superfamily Cadherin-like 6.57e-19
Family Cadherin 0.0014
Further Details:      
 
Domain Number 14 Region: 2049-2254
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.12e-18
Family Laminin G-like module 0.025
Further Details:      
 
Domain Number 15 Region: 6414-6542
Classification Level Classification E-value
Superfamily Cadherin-like 1.4e-18
Family Cadherin 0.0017
Further Details:      
 
Domain Number 16 Region: 5660-5775
Classification Level Classification E-value
Superfamily Cadherin-like 5.42e-18
Family Cadherin 0.002
Further Details:      
 
Domain Number 17 Region: 409-502
Classification Level Classification E-value
Superfamily Cadherin-like 1.14e-17
Family Cadherin 0.0017
Further Details:      
 
Domain Number 18 Region: 7369-7487
Classification Level Classification E-value
Superfamily Cadherin-like 6.94e-16
Family Cadherin 0.0051
Further Details:      
 
Domain Number 19 Region: 1604-1709
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000134
Family Cadherin 0.0016
Further Details:      
 
Domain Number 20 Region: 1836-1967
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000214
Family Cadherin 0.0023
Further Details:      
 
Domain Number 21 Region: 634-760
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000228
Family Laminin G-like module 0.008
Further Details:      
 
Domain Number 22 Region: 3166-3290
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000614
Family Cadherin 0.0061
Further Details:      
 
Domain Number 23 Region: 3391-3511
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000871
Family Cadherin 0.00093
Further Details:      
 
Domain Number 24 Region: 3617-3749
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000842
Family Cadherin 0.0047
Further Details:      
 
Domain Number 25 Region: 1705-1849
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000899
Family Cadherin 0.0032
Further Details:      
 
Domain Number 26 Region: 6097-6224
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000157
Family Cadherin 0.0053
Further Details:      
 
Domain Number 27 Region: 7260-7364
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000357
Family Cadherin 0.0028
Further Details:      
 
Domain Number 28 Region: 301-419
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000428
Family Cadherin 0.0034
Further Details:      
 
Domain Number 29 Region: 7966-8063
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000614
Family Cadherin 0.0059
Further Details:      
 
Domain Number 30 Region: 8170-8295
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000285
Family Laminin G-like module 0.016
Further Details:      
 
Domain Number 31 Region: 6834-7016
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000335
Family Laminin G-like module 0.024
Further Details:      
 
Domain Number 32 Region: 2318-2461
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000112
Family Laminin G-like module 0.046
Further Details:      
 
Domain Number 33 Region: 7578-7744
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000811
Family Clostridium neurotoxins, the second last domain 0.084
Further Details:      
 
Domain Number 34 Region: 6670-6752
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000013
Family Cadherin 0.0048
Further Details:      
 
Domain Number 35 Region: 5777-5875
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000113
Family Cadherin 0.0055
Further Details:      
 
Weak hits

Sequence:  PTSG_07016T0
Domain Number - Region: 1429-1480,1552-1602
Classification Level Classification E-value
Superfamily Cadherin-like 0.000288
Family Cadherin 0.0075
Further Details:      
 
Domain Number - Region: 1511-1552
Classification Level Classification E-value
Superfamily Elafin-like 0.00034
Family Elafin-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_07016T0
Sequence length 8457
Comment | PTSG_07016 | Salpingoeca rosetta conserved hypothetical protein (8458 aa)
Sequence
MLASTAARLLVAAAALACALLPPNSGARGQAVLLDPPRQDTAVSFNEADGSVFFCQRASL
TAASISHMTITVDPITSTLEGLTAASDTLSISYSSDDGVLTIDGPGSVAEFQSALQSAQF
FSFESPPNRAERTVLVSAFEDDASVLGSAVASVFFGAVVIPPRLDLNTSDNAQPTQIGST
DPLDAQVLFTEGSAAMTLFPDALVLDEADNVTTIMLTSSISFPDGDAEVFMALPGVSLET
TDASVTITLPAATTSEEASVVLQTLKYRNTADEPTAGQRTFSAVVTNGAGLTSEAATLKL
TVRTINDHRPSLLLDAFTVEEEKAGAVGRLIVVDGDRNQPSSGTPTITIINSTLEDGAVT
ISQTHTLLLTRPVDRDTEADEVVLTVRLSDSQLPPLTSVQLVTITLTDVNDNAPVFDAAT
VPSTLIVPETTTAGVSLALLEATDLDSGDNGRVRHRIASSMPSQAPFVIDAASGELFLSQ
AVDYDVEDSYQLVVEASDQGDVCQVEQPATDGPCVTTHVLDITIANQNTIAPTISNVPAS
VTTTENDPPLAPLASLALDEGDGFDTWAQASVSFTRQAALSRLLTCPNQASFAPRAGVWD
TCGFSTTAPTPLFADAVARGDATLVNQQIALLPSTGQGHVAVPDTTYQAVLPVLRSGFHI
TAWIKQAAGNSGYLLAVTSPDTSKQYLGVFSQPASGIISVLYERDTAPAGVSSLTTLRFA
VPAQVSLADGTWHLLSVALRGVSARLVIDCTPVPLQSIEYFTAASGGGMQAVTNTAPTTL
PGRPVFGDDAMFLVGVRPVGATGTRFPFAGDVAALSVLPEDNSLADAHLRWCCALGCGTY
ATVDLTRTTGGAPAHTDVFSQATVNAQGLDLASLRLNGPHSITAQPSEGAVLSTAALQLL
LRLTVVGYALDEPAILTQQQQQQQQQQQQLSLVVDDGGLEARADISISISAVNDHAPVLD
LGGTDGNYAAAFVEEGDPTPLSAPQLLVITDADVPSSGQPANMIATAVITLENAPDGAGV
EVLGWDQQLATTLGATVSVRTTPSPRLTMTGPLSLADFASLLSTITYTNTANEPQGTTRV
VTWRVSDGVHDSEERTTMVSIASKNDAPQVFAGGSTNSDNTVTIVEGEAAVQLCPDAVLL
DSDDTQLRSVTLQLLNTPDNDAFNATVETLSVDTALATLLNLTVSTTVTSPTDNDNNENG
LAARVQLVVSVQQQQQQQQQHTQSIGAFVAVLRTARYTTTLSTPSNPSTEPRELNVIAVD
AQGLASEPAHITLFFTAINNAPWVDVNGPDAPGTDATAVFHEGDLPLMVCSSATIMDVDS
PMLFRVVVELVDGVMDGAFEGLTIPSSALPSGVTITRRNSDAVLVLEGQATPLAYAQAVQ
QLSYFNFADEPVPGVRTIVVSVTDGGDSSADFDAETGMASVTVTVVSENDLAPFFLTPVN
ATTSVSENTAAGAVVARIAVADEDLGIPANLTLNVVGVSYAPAPSSSPSPVPALDISSWF
ALQVTASLSPECPQAEDVVSPDCAGSSCVGDDDCVGFQVCCPVACGSVCVDPTPYTLHAD
VVVTGLDTIDFERVHQVALDLEAADAEFTHTVLGSVTIGILDTNDNSPSFADDEYVVTVP
EDLLLDSVLVVVEATDADAAPFNVPLFSVAQDVLNASFCRVNATTGEVHLAQHLNRETEA
EVQCIVQVADAGRPGVVSDTARVRVLLRDVNEAPPAFPFESQMLPVSEDVQVGYEIISFM
LTDADQAPPNNAITVELLPESPSEPGTGPGPLPFEVQVVDQYSVVGAAGELSVRVVTNAT
LDRERRQAYALRLRAMDGDATMPESERMLAYAVVIVLVSDVNDNAPLFSAVQGQQLRWSE
DTPVGTVLLELDVTDADILDNARITTSIRAQSPANTLRVEMDTLEVGQQRVAVVLAAPLD
RETAPTIALRLLATDAGTPVAMFSTLELNLTVTDVNDNAPVLTVSPFGRSEPESSSSSPH
YPLVASTVTDADASLGITGAAVRAYTERDPALESCTAQSASTVCLSAALDVTGAMVPAGT
LATDPAYDSADGAEVWLFNGNNAYGVVQTQTVQAFGSVAGGSFSSSCWLRVAQDSDGGYV
YAKTNAAGDERFYALYLSSQAEELWFSYQRERGTGVPAANARVTAKFSSPALMDNAWHHV
AVSVNHISSTVVAYVDGAALGDPVIEERNDAGTRLDPHGNPLTSALTDGEGLLLVGARSS
PSGASLLFEGQLSSLLFTRRAINRAQLGCLVQCSQPLLDATTGSSSSSSSSSSLLQQERP
MVAGRCTDASAAARVVDACGLGAAELPLQELRALQPRNFDTREDTLFMTPTGYTPMPVGS
LSPSRISPESGVLLVCTWMQFLLSRNDRSGYLFAKTSIDGSTRFYTLYVREASQELWFYY
KQAGASGVASRVLVRFSVPALFEDDLPTWHHVCIRANNLTLHAILDGQQVAPSAITSRNR
ETGENEGPYTLPLRYRLDDGAGVFVLGARNESASSASGSLAARVADTLVAFSNVAGTDAW
RCVARCGALLSVTVPSSVNSGRTVPLATTTSSGGDELHIVVDAGSNPLSASDAVAVLESV
QLNVQLLQPLLLSPAATAIGGGGSAQQPCFTASASVSDQDFESALAFSETCLTAENEHAV
VVDLDVTDGPASTNPNASRTFVEEQGTPTAPLRHVFVYDSDETTNGLQLNVTLLNPLDGP
SAESLTFDTDAVAALGTSSRSTHALTGTGSLSAVLDVLGTLGYINTADEPTFTQRVIEVR
IADSNGLEAQPPAYMLVTLESVNDRPVLSVVPNSVGAYNEDAAAYHVLSDAVVTDSDSRL
LREALVEFVQRPNGEQEILFVNSTVVDQVATPAGLSIGFDEQVGVLLISGTAPLSTYATL
LASVLYRHLDTENPTLGTRRLQLTVTDPTGLQSDEQTVEFSLLTNRDAPIFDLSQVDLAP
AFVEGDAALPLLALAGLRDGDSAELSTLEAEVVDVADANMEVLMIDPSSLLDPDSVTITT
TGGGAVVSVTGPAPVNVFEQLLQTLTYTNLADEPSPGERTVCVTATDTSFAATRVCLGPT
VVPLNDNAPQFSQSVYVHSVDENQPASTPVGSVAATDGDMFDSTLVYGITSSQPSPAPFE
IDPATGAISTTATLDREAIALYTLQVSVSDSSTEQPARTATAIVLVDVTDLNDNTPRFTV
SPPSTLHVAENAGGRVVLATLHVADADEGLNGPPGLSVTVERGSDAVRIADEGNGMPQVV
TARSFDFEVEQTIAVTLRLADSGTPSRSVTANMTLLISDTNDNAPVFSSSTPALVRVREE
IPLGSLVTQVAATDADRGANASVHYQFNTTAMTAAALATFEIGAGSGEIRTQARLDFEQQ
RAFELVVQAVDDGTPTQQVTQHTIRVEIIDVNDHTPQFSQDVFFATVAEHASAGTSVVLK
GGGSGVSLVVMDADTLAANTDVVYSLLFDVGSPVAGAVAIDANTANVTATLIGGALLDRE
EVPWFTVTVLANSTVAPFLSNTAVLNITLLDINDNAPVLGPLPHQVDVPEDAALGTLLLS
LTATDADAALAGTVRFSMRAGSTSPSQQLPFDVDAVTGRVTLAAPLDREAVSTYTLVFTA
TDLGEPRLPSNETTVLVVVTDVNDNAPHFTSIMVVSQIEEQSRASVGTFVAEDDDEGVNA
QLTAFLRVHTADGTDVTGAGIFNISQPSPLQAADSVAVARPALLDREVLGDVLNVSVCLR
DGGSPPLQTCMAFEVQLLDINDHAPVFDAAVPNAVDVIETTAVPSRIVQLLAYDLDTGAN
GDVEFFLNSTRPANAPFAVSQQGMVFLSGPLDFEMTKEYVVTVVARDGGSPPMQAFHTIT
VSVLDANDNTPSFVGAPYSVSVAENAAVGSFLSLQLAATDPDTVASNLMFSLENAAPSAD
FHVTSDGRVQLTSPLDRETFASYALLVAVRDGDGHADTATVGVTVTDTNDNAPVFDRGGY
EFVVDENAAVGTPLTPETATIAATDADAGANAQIRFSITTTTATVPFGINTTTGMLYTAA
PLDFEAESVHVFRVEATDLGTPALSTSAPVVVRVQDTNDHAPSVTFSETAASAVVFEEDG
GAVFLFDDRLQLTDADVDFQRLESATLVLTNARDSLAEEQLLPQLLFPGITTSEGVNAST
STRTLAIRGEATIPAYLRMLRSVQYTNTAQEPLPGRRTLTLTVNDGVHVSQPLQVTLSVR
QLNDRPTSSVSAFNALTIEEDSTNPPAFDVCALVDQLGSDVDPQPRRGLGIVVVGVQASA
GTWQYALRSGGQSGPFTDMTDISLTTALPLACEQVRLVPAADFFGAARLIVLVWDQTQGR
TGLGPLDASLLLQDPRSSVSQQAIALTINVTPVPDAPIIAQEDAGTAWPSPTVTFAEARS
PVHVFPNVSIVDVDSTSVSHATVTLVNASAGSDVLVIAFGADEQQVAPAVADDEGSLWLN
NTAARTACAGIALSYAEHNAQNQTQMVVDRTVLTLRANTSSQASVPLSVMVYCLRHVAFA
STAFEASLQARSAVLTVYDFDESRFRPSNLSAKAATTVLIELTNDEAPVLSFASELDANR
TYTEPSQALGEPTPQLAVLPSIVVSDADAGFPLAAATVELVAGTVQDSGDEELRVDGAAS
GRSLVLPSGSVADVQARLRRVVYVNTRAEPTPGVRVVRVRVHDGTFQSNVLEVRVRVVTI
NDRAATLFVGDGSPFYQTSFTEDSAGVAIVSPNLQFFDFDNAVYPLLGVTACINEHTTGS
AGAQQAIVAAPTWDNTSTTTISPGNNNACVRVHSTSGAVADYRQALLALRYVNTEEEFTG
ASRTISFTVEDVPGVTTMTVTVITLVRVNDAPIIAFSGFTNGSSMLQSVRFREGSSPTPA
LPGVVASDTDSTFLTGAFVTLVSAPDGDSDVLTVLDLPTSAGLSAVFCSASGVALPVNGT
VPAGVWDGNGMVLESCTSRRTLGIRGLARVHVYEQVLRSVAYVNLLGLDERAGNPTRDTR
VVSSQVVDEQGAASAAIRTLVLLEPVNNAPIVSLTGDDTLLSGRDATTAYVNYTEESGVR
TLFPAASVVDVDSANLTWLSVTLVDRPDGSAEELAFSSAALANAAFTSAAQRGHVVSVQG
TAPVSAFEDVLQSLTYENSVDNPDMRDRRVDVVASDGINTTLVHAILQFQAVNDPPVVHL
RGAVNGSSAVQLSFVEDAGLPVSLTGTRSPAWEGEYPLTNSTCPLSCDCCLSGSLVVDPA
TSAATSSLHNITISIDSVAELQTICTGYFGGYPTASLVGTVHNATHITAPLPGLQGGNVV
CERSFPEDAVDGTRPSIKCSVSATCPTTSFNGQCNSTSCGVRSVVDITDEDNTELSGMWM
SIRARVSLEGDAIECGAAATSFNLALVAINDTVDVDDATIRVRTYWVAPATAQSAPLASF
QAYLASCGYVNVAAEPFAGTRNISVVVCDGTDNSVPAPVTVEVVTINDNTPVFDVPVYLA
NISEAASVGSHLLTVRATDADRQTVTYSLNHTRFGVDSATGEIRTTSRLDRETSAATVLR
VTASDGERSAVVLVHVTVLDVNDNKPVFSETRFVGIIAEDAAGGDTVLEFNTFGNLPLFL
TATDADAAANARISYSLAGPASALFEVDSASAQLRLKAGAASPLDYETRRSYVFVVLAQD
AGTPTRFADPAVVEVLIRDVNDNAPVFDGASLNDVVTSEASPVGTVLRQVVAHDADDNAN
GQVRFGLHDTTTASGGGSTVATVGPFTMYGNGSLVLTQPLDYEVQQTYTLTVVATDGSTT
QAQHTLANLTVQVLDANDNCPTFTVTPEQASFAEDAGPERLLATVSIADADAAATNNITL
TAWRAGNNGQASASDRPAVVQTGESVYQVLLGGLVLDREQAASVDVVLLVSDGVCKVNRT
FALTVTDVNDNAPVPDSTFVRASVLENLPAGTLVTVLNASDADAGVNGRVVFFLAGASNS
SNPYVEVTGTGEVRTLRQLNREALQQITLVVGMTDTGVPQRRLSATPITLVITILDENDN
SPQVISPGSSVVFPENNAVGALITTVVARDADAGANGELTFSLIGGNDGGEFELDANTGE
LFAAVKFDRETQHLYAVLVRVSDKGTPSRSTPMPIAIIIGDVNEPPVITAPAPLSTVNVK
EGLPVGMLVFSVQSTDPDTSGSNTNVYELETTPSGYLAIDEVTGDVTMATVVDVDVLGAP
LVLTATAIAHDRSNASLFAAVRFTVRFVDANDHQPVFSLQPVQVSEAVAPGTPVLEVQAT
DADITSANTGLRYAVVSTTAPGTAPVAFLAADSPVLVTTSSLDYETAANFSAVIRVSDTG
SPSLSTTHVLQVTVLDVNDEAPVFTPANVAVSVPENVPGVELVRLHAWDRDTGAGGAVFF
SLVNGSSFASVNATSGVLTLESALDAEAAQTVRVLVRATDGAVPFNTRDSVITIHVEDVN
DNAPVVTADRNPVEIAEGRYTAHVLFNLSASDADVGSAASQVRFSLVSSDGFPGGVYVDA
VTGAVRTATASAGGSVLDYEQRTSYVLTFLASDQGSPALSSTISVTVNVTDVNDNAPVIT
SSPPATLGVLESTAIGHVLFSITATDADSGENGRVMFTSATPAVVSVTSGGQVRLAQKLD
RETRDEWDVAILVADSGAPPRRVWVNVTLRVLDVNDNAPVFCSLDSLTTCTPITVLNVTV
RELAVGNFTIRTTDADAPGVNSAARYSGFGDPRVSINQLSGLVSYNALTYESNSPVVTYT
VYASDLGSPRFISQLTIRFSITDINNNPPTASLGDFRYLVGRQDMVVLTSLQVQDADTQS
PLERAQVNMTRTRTCSECAGAFFVELTPQMIPANGATRNADYDSVEFAGSGQYASLDETF
SYPTFPQNELGDIAAISFSLVFRLEDGASGFLISRSILNQHAPAYSLWATSQQLAFVYNA
EGDTALVQAGDVQLYRIEFDLAEPIDDNEWHHVSVRLIFPTTLDVEVDGAVVAAARVIRP
DGSTSTSPLPLTQTPIDNTNAVTYLGARFDPSAGATESITGAVRSVFLGNETWPTALARC
LGACHQGIRVDVDSNSGITATRASIDATTTQITLSGSASIATYTQALLGIRYWSDFQPPT
ATPVATLSVDVFDGLFTSNTATAGVYVVDNTAPTLDLNGAGASGVDNNLIVTFTEGAAAP
VFVTPAATYTDDETAGSTASIIQVVITNALDGALDELSVESSLVTVQPSVSVNGSTATWT
WDVSTAPLSAAEMTSALQTMAYKNSADEPAASATRALSVRVYDGAEWSNDALARVQVTLV
NDNAPVIAVPQSGQVQEGSAVGTVLVSFGVSDADACVSPLATSCSDNQVAVTLQADSESQ
QYVSINSAMTAVVLSASVDRETVASLSFNLTAQDGGSPALSTTVGPIAISVLDVNDNFPS
VFTDFLSITVDEDAAVGSVVGKVEAFDGDATAAFSTLQFSLSPSTPLSIDADGVLTLNSA
LDFETASFVSISATVSDGQFQDATFIDLQVQNVNDNAPEVVLTPALVSEYVEGSGPVLVD
SGLSVEDADGDLPLESAVVRVTTPVSGRQCLVDVAANDALLAPHARLLRCHDGLSTPLIG
QVQDPNAFPVTVPAYRVLPLPRSLRFTLTAWLWLSDSNSTQCVLNALDETAPSPSDALLL
SFRLSVTEAVLQFVDARAREVQVVFPTTVPTREWVHVALVLRGSTAQLRVGSSVFDAAYV
REDGVVRPPTIRQPLTATAASAFDVGGASTQAACARFQGLMVGLTVHDASLTTAQLSCLM
SCGESVSVPTSASASAGLAVTTAVSSTGFEVNISGPGSLSAFSAVLSALTYEHKQHAHQG
TSVGFTARVYDGVWNGTAAWTVALTPQQSPPVIASRSPDGLVFTEGDNAAGAPVPLSDAM
LSVVDVDSTEFTSLSFELQQTPDGVDEGLVVTRGPPTALTIMGDRVVMTIMGPAPLSTFM
AFLPSLVYVNTASEPTPGPRGLLVNVTDSSGQTAAPLALNITVVNVNDNAPALAQVLNSV
DVPENSAPPLVLSGLFTATDADGDALAFSVAPPLDTVFSASATGLVLQQRLDFETGAAEL
NVTVVVSDGAFTTTAVVAVAVLDQVEPPTLALTSGRTFSQSFSLDALVQTTAGEGIDALQ
QVRVVLPVDAANAVPSTAVLTTLPCVDEPRLSVKLTRACAAGLCDFDTASLLTDAVYRGG
ATLDTAVERVSFRGSGRYAMLSSSFADALVATSSTLDVGGVVTWVQQDAGTAGMLVAKSV
SDFTHVFALYSDGPDSSVTLYYSKAGESDTTVARVTAVFELPAGVVIADGQWHLMQLLVA
FPDVHLFVDGTRVPLSYALHRPTTQSALQRVEGPQLPFRLADTQGRAWYIGAREDSLAGA
AERLSGELSGTTFLSATAPDSLNGTATHDLVTSCPERMQSSEVSVAGVTVTRTGPLDVSA
AFVDRTARTTANVNTVLQQLVYSSYVPLADRNVTVDITYGQTYNAHLRQSTTFTLMT
Download sequence
Identical sequences F2UDT3
PTSG_07016T0 XP_004992428.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]