SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_07019T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_07019T0
Domain Number 1 Region: 277-316
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000129
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  PTSG_07019T0
Domain Number - Region: 222-284
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000158
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number - Region: 350-404
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00793
Family Fibronectin type III 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_07019T0
Sequence length 2336
Comment | PTSG_07019 | Salpingoeca rosetta hypothetical protein (2337 aa)
Sequence
MAGNTAAWPRRSQQVLLLSLLILVHTTPAVLGWINGWGDPLSFECPTGSSISFMGSYHDN
DEEDRRWKFSCSPVSTGDGTGASWSNWANDWNANFAFSCPENKYVNGLSSEFDDETEDRR
WKFKCESISNAKLTDCREEFTFTNEYDEEGSYSVGERVMIGWFSQNDDDRDDRKFKPTTC
KMECDKDSGYRLINDRECERESLSWRNARQTKAVFASDVVSCDPLTLDGGSTSGDCGGAF
GDECTYDSCDEGYTLSLSGTKTRTCGWLGDEASWSGTDKSCDDIDECSTGEHDCVDGAVC
TNTPGSFTCACVYGSLSGGQCVVPAPSVGMSVSLASISFSVSGSWSSEFPKYQISIARWA
YDLSSYTDISGYPKQVTGSLTSHLASGLSAGTRYRITLTPLNENDEPMTHFEHIAYQYGT
TDPQTPCGCGGSSGAPTDFKVKQFKGHILFEWADQSQCESAFTFTRNGVGLAARFDVTEQ
QACGAVQKPLSISDDLTIQSPGGYAEVDSSINYKLPDGSFYLRLSTAVEEGEMRLKYPRE
LQRDGGHFASTSTTTTAAPQGVPDDENRYYPGTSSPVASVTECKDLCDIRSSWCIAFVVQ
TKADDTLVCHQLRVVETAALKSGEKKAVSYERVTVSGTGVSGSYIFDGTQDDCEQACTDS
GSCVLTIVDSGVCGIINSAATTGTPASSIHASLDPDFSRRIPGPEPGRTQTYCIAATNPT
WYTEGGYSSGQTCTSYTIQWESQLEGQITIDSKEIHLPVEHVEIEYEIGPIRGRRVTNED
GKFFIHILTDQLQGNRHRITLRFSKTTGNIKHTFTCGGIACTETTLIMEHLRFDHQVNVK
DTTSLPFSGIVSIGGTEHEGLPDGCPLKDVEVCLYDRHQANTLINCDVTDSKGRYLVRAV
LGTSVTVSLAYGNSSHTFERVTYDQDAANAPSGILQTINALNSLERTPYYDVTDGKFWEN
INFKDTMSDRATVDIAGGLCNLNLGDAVIEFRYDMCPTWVKSRTISDRLSKWTLPAQIIT
VRFKEITRNYEVRGEITRYFSAKLGNSRSLYLDLRNPQEDDEDKKTVRFEYHPPPQLSVE
FDKEEKHNCNSTEGDRPLHVIKQNVELKATVKVIEDYGEGVGTCDAVPGQIEVENQLGES
PATVDALNATTSLTDKQLNKLKLCYDTCLMDVKMDEELQDGETVYSNTRIELNIMTGEPE
TNPQAVNPENPYSKLFRVTMHNLPQDPVSVYEKVVVVGDKVISKYFSVPFPRYQPLTVIQ
DPPGGLSTVTYSKAYTNFLVDSHTHEEYHGFYFTTGLAPVKVETGVEQCVGLGAAVCTKV
ADTESTPFKLTVDQTHTFGNMDPDDNYGTERVWSFEIELTTSDDVMLAGERSDMFLVPAL
NVVWMETEEVSFDVEQCRASKETKVKWSLEGQDNSELITWISAFEIENKELPDLRKLLAL
AEEPPGDDDDETEEDRAEKVAELKRAIKAWEDNLDRNKEVRDKAAAGTLDPVQDLWSKTS
AEHDCAPPLSMIENPKKASKLLSEASKVNRCDGFGAAHIKDDAGKGISLAPHDLIDGATD
LDDKEASDQDKQDLRSIKTIKFSGGGSTYTFGFDLEQTKSAVGGSSRTHEVTAGVDVEFG
FKVFGVGMSFELSTGYNYEGTTAEEHEAGVTTGTHIEFTLGDPDPLDVFDVQVFLHPDYG
TLVFHTTSGQSSCPHEPNTVQLEQPGISVLTRPEAPVLPGEPAVFEVLLKNDGPMTSDFN
LFYLSWLNQDGLEVVANGQALETPLIFEGFPGSSAKYLTITVNQGPSKFKYDPVAIGWRS
LCEADRHPDNGYVTDEVTSVEYVYLEAEFLQPCSPVKLVGEIGESGAFTLNQETMEQDYK
PGQIRVVAFNPDHAERTWLEDDRLEKVVIEFKPVNSYIWLLARDENGDALDIRERENEYG
YITSWWDASTLLEGDYHLRIRAQCQASINEVPDGIDEKLSLVAAGVVDRDPPVVFGFPEP
ADGEFFPGDEISFQFNEDVECRQPFIFQVSLTVEDYDRDFNNNNMVIVCEGRKISMSLRR
GFRYDEVNGLTATVIIENVKDLNDNRMEFPPEHTFKFAELTLEDASASVSGLELDIPFQA
VYLDTASVIYTNFTRDLAREIAALVDVPAYRVEIVLVEPVDENDYTLGTSVTLKFAPAST
QAPETQALQRRRRAVGDEIQLSATELANVLQQRIANTTLTSNFTVLASANADISLGVEVE
PSEEDTIQYQQSASTSTSTSTSSVWADVNLGTVVILVALVMQAAVLLFAMSRMQRNWLQE
VMWQNGGKGSTEQSSLQDSKRPISTPQSRPVTSFARIFSSKKSAVVVPFDVDESNA
Download sequence
Identical sequences PTSG_07019T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]