SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_07046T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_07046T0
Domain Number 1 Region: 1694-1867
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000119
Family Growth factor receptor domain 0.0068
Further Details:      
 
Domain Number 2 Region: 1822-1963
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000283
Family Growth factor receptor domain 0.0052
Further Details:      
 
Domain Number 3 Region: 1648-1694
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000241
Family TNF receptor-like 0.0031
Further Details:      
 
Domain Number 4 Region: 1544-1581
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000005
Family TNF receptor-like 0.0018
Further Details:      
 
Domain Number 5 Region: 1461-1500
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000913
Family TNF receptor-like 0.0025
Further Details:      
 
Domain Number 6 Region: 1504-1542
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000971
Family TNF receptor-like 0.0029
Further Details:      
 
Domain Number 7 Region: 622-664
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000673
Family TNF receptor-like 0.012
Further Details:      
 
Domain Number 8 Region: 797-836
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000785
Family TNF receptor-like 0.0083
Further Details:      
 
Weak hits

Sequence:  PTSG_07046T0
Domain Number - Region: 1614-1658
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00025
Family TNF receptor-like 0.0076
Further Details:      
 
Domain Number - Region: 1006-1051
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000518
Family TNF receptor-like 0.0074
Further Details:      
 
Domain Number - Region: 758-802
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00572
Family TNF receptor-like 0.025
Further Details:      
 
Domain Number - Region: 1586-1617
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0287
Family TNF receptor-like 0.0034
Further Details:      
 
Domain Number - Region: 1100-1142
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0393
Family TNF receptor-like 0.0093
Further Details:      
 
Domain Number - Region: 889-917
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0437
Family TNF receptor-like 0.0032
Further Details:      
 
Domain Number - Region: 1243-1287
Classification Level Classification E-value
Superfamily TNF receptor-like 0.05
Family TNF receptor-like 0.0097
Further Details:      
 
Domain Number - Region: 1342-1381
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0636
Family TNF receptor-like 0.006
Further Details:      
 
Domain Number - Region: 258-280
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0976
Family TNF receptor-like 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_07046T0
Sequence length 2034
Comment | PTSG_07046 | Salpingoeca rosetta p75 neurotrophin receptor b (2035 aa)
Sequence
MPRRCGHTPSTSNNNSTSNSSKPRARTPVALALLVLLGLLCTLGAAQDTTTTYCLDDTVL
GACDGLATTTTNSTDCSQSTLCSCVNDALVPEEGPPCICSEEHYEDSSQCLPCTSECSTD
QFESQACTPTQNRQCQTCTASCTEGKYLTPCMATADAQCVDCTICDTDQYEITACTTNSN
RECTTCTVCSSNQYQVADCSDSADRMCASCTTCTGDTYASTPCSEEVDTVCSDCSTCTDT
QFLTAECTPTSNTMCEDCSTCDEDQFVTANCTDTEDTQCQACTTCDPTEYQSVACSAFAD
SECLPCTTCEDTEYVQQPCTDVTDTVCMACSVCDAPEQFTATNCTTSADTMCSDCATCGA
TQFETTACTQWSNRECQDCLECNPGEYQTRNCTETADRECALCSQCDNDEYISVACGVTT
DTVCADCAVCRSDQYETSPCTEVADRTCANCTECEPGFFTSRECSATLDRNCTACRTCAD
DEFETVPCTASSNRECQACSTCDPTQYILHACNATANTVCDVCLTCEPGTYATGGCDGVN
QRTCGPCTQCDFDNEYETHACEPLADRVCTNLTVCDYDAMFMSVMPTATTDRECTALTVC
DTATQYESTPKTVTSDRICSPISSCDAGEFETRAPTPTTDRVCALCPAGTVDDNGDGLGE
CVQCPAGVYTTNGTVGPCSAYQCPVATADLDMNPATACDDCNGVTNYQNEEGKTTCKVVK
DCPPGQEENSPPAPNADRTCRFCVLSRTYKPTTGQAPCMNTTTCPPGMEETTLATRSSDR
QCTMCADGKVKEDPGQSTSCVPHYICPAGQRESAAPTASTDRVCEDCPVDFFKTSPGQDP
CLEVDVCSQMEYELRAPTTSQDRLCEPITVCTSEQWQSTEPTATSDRVCEACSTCPEGRL
EVQPCTPTSDRVCEDCSACTEGVQFIAQECGVDDTVCQDCRTCLPTEYETASCQLRRNRQ
CAALTRCTGNEYEETPPTATADRVCLDLTVCTSLQYESLAATDTSDRECTQLTQCVPGQY
VSRAPTSTTDRECTVCAEGTTDHDSTASTPCQSCSAGTYVPEGSAGACSTFVCRAGTIDD
DEDASTACVSCVSGVSHQPDAGQTACVPVTVCAPGFTESIAPTAVRDRGCSACAMGKFKA
TPGSDACEDWAVCSMSTQYIAQHPTSTSDRVCEDITECDAITQYETVEPTATTDRKCTAL
TTCRADTEYESVAPTPTTNRVCKTLRVCSGDEFEATAPTATSDRVCLPVQSCDDGYFIEA
DATPTSDRVCTLWTVCDADEYQSVAPSLNRDRECTKISACVDGTYETASPTQTTDRQCAD
CRTCAAGTFESQACTASTNRACTACSPCAEGDAYEMQACTPTSDRVCSPCSMCMDGFFID
ATCTALDNTDCSRCSRCAQGSYQTQPCGAAADTQCTTCRTCTAGVTFATGGCVNELDTEC
TPCSACGATEFVSLACTPTTDTGCTACSVCPIGKHIDQACGETTDTVCAECGNGKYQDTP
GAQACKDCTSCQAGTYIKSPCGVAVDAVCEECESGRYQDQSDKASCKRCSVCPAGKKEVQ
ACTASSNTVCQDCEDGFYQDEGDRATCKRCSRCSPDEYEEQACTSTSDTVCVACTTGCSP
GERVTASCSDTADLQCSVCPTDEFQASDDHLDTSCLTCSTCRRGQYVTRSCTRTLDRTCA
SCDPGAYSDAENAQECAKCGHGTYQERPGQTSCTECVSGTASSVTGATSSDVCAPCDVGQ
YQDQTGQSVCKRCPTGTANGITGATSLDDCVSCSLGSYQDESGKGTCKECPAGAYQDDMG
QTGCKQCARGKYSNVVAATTVNACQDCRQGFYQPQKGQTSCVPCAVGHFSTTTRAISGSV
CQACAEGSYQDQDGSNSCKMCPRGTFGSVTAATSVDDCSSCAAGKYQPEVGQTACIECPR
GTYTNDMRQTSCIPCDETEFQDKTGQEACKPCIACLDGYTDVGGCNRTHDRICKDIDPPM
IVIVDSNNNDIADIYIVEATDTGDYTPLQARAFDAAEKKSLPVTITGEDNNLCL
Download sequence
Identical sequences PTSG_07046T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]