SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_07191T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_07191T0
Domain Number 1 Region: 1059-1367
Classification Level Classification E-value
Superfamily NHL repeat 2.2e-33
Family NHL repeat 0.0004
Further Details:      
 
Domain Number 2 Region: 378-441
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000153
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 3 Region: 627-690
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000032
Family Complement control module/SCR domain 0.0032
Further Details:      
 
Domain Number 4 Region: 891-959
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000431
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 5 Region: 453-505
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000556
Family Complement control module/SCR domain 0.003
Further Details:      
 
Domain Number 6 Region: 706-743
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000723
Family Complement control module/SCR domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_07191T0
Sequence length 1426
Comment | PTSG_07191 | Salpingoeca rosetta hypothetical protein (1427 aa)
Sequence
MACAQRRAMLALLLFAITSSRLHVAVGQVNNWDGSLYYQCSAGCGLSYVSSYHSNNREDR
RWSFSCASVGTGYSSSTTSSGFYDYAEYDRPIDMSCATDYYLERLQSVHSNSKEDRVWVY
GCRRGRDVKLLNCGITGYLNDFDAYLSYTVSSNRIITGLASYHSNHNEDRRWRVRYCDVE
CDLGNNYVNRAGTRQCDSLPTTSISNNVYVNNFRQPFSVQCPDNMALISLNSYHDNTQED
RRWYFACQVPRTRGAQLSRQSWSAPTYGQLSSTVSFTCPSNSFLTGMRSAYVVGNLDRVM
SFQCSSSADTRVSTSCYTSSSNSYDGALRFASSNIYVVTGLTSYFSSWSRDRVFRFTACR
LDCAPGTQAVDGVCRAIVCPPLTLASGSATGTCNGAMGGLCSFSCYTGYRLEGSTSRTCQ
SNGVWTGSTTSCERITCGSLTHSQITMTGSCGGDFGDRCTYSYCPSGYAMRGSTTTRECT
ANGWTGSAPYCEKLECPAITSISGGYLSGECTGNLIDVLYSHSLSHGSLGVEDDRCVFQC
NEGAVLSPRSEVGVAIKCGQLSLANGLRSGSCGGNFGDVCALEECNRGYRFATGGATTCN
CGEIGGVSQWKQGPSTACPARTCEVVTCNAVHFTNGQGSGLCDGTVGGQCTLQCNTGYWP
SSEGSTSATCVLDSSGHSAAWNAKFATCKGFHQRFLQRQSDQCRYSSCNDGFRFGAGGTS
VRTCQQNGANAYWSGAEKTCVEVIERSGASDFKVTCAPGQAFTAMYYTAASNEYAYVCED
VGDDHDQRIFTVPEEQFISGTYSRYCDFNTYATSAVSKAGASFEYECSLLIGVTLTNCRL
GGTLSGSYSVVAPEGSVIAGMYNSRSATPRARVCDVQCREHDGYYASGSKTCRRLSCGEL
TLENGSISGKCKGRKDDTCTYKGCDNGYELSSTGTGTRTCTIQDGRAEWSGTPKTCERIV
TTSEPTTTNPCTGLRRAKDASACRTRCNQNNQDSTFFRYYEGCTHVCTCGCRKQYAIKGD
QEQCTAHCASLGGLQGTHYPKHGGCRNVCLCTESGTRSVAAATTGSQVAVTGTSNTIKTV
AGNGKTAWTGSSQPTQTGLNQAECVAVDGSGNMYVALRTGHRVVRIARGDGAITTVAGTG
TAGDSGVGGAAASAQLNRPTCVALDAAGNVYISEEGSHRVSVVDATSGDLSVLVGTGHSG
HRGMGGSSRAADIHTPRGLAVDNDAKVLYVADAENHVVYSVDLRTLSINVYAGTPNQRGY
RGDNGPAVLGFLNGPTALALSASSNRLYIADTDNNRIRLVDLDSGVIDTIAGSGLSGASD
VVGSSSVPALEAKLNRPEGVAVSEDGDQLVIADTTAHVLRLVQLSSDGAPVSVVAGTGKS
GYVADNNSRTAADAPMDTPVSVAYDVGEQAVVFVDQQNRRVRRLYF
Download sequence
Identical sequences PTSG_07191T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]