SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_07261T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_07261T0
Domain Number 1 Region: 1481-1602
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.00000000017
Family Cellulose-binding domain family III 0.014
Further Details:      
 
Weak hits

Sequence:  PTSG_07261T0
Domain Number - Region: 348-391
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000138
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number - Region: 1657-1723
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00118
Family Type I dockerin domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_07261T0
Sequence length 2735
Comment | PTSG_07261 | Salpingoeca rosetta predicted protein (2736 aa)
Sequence
MLVQVVTAVVLAVCAISTTLTSAAAPCTPAPCVTYDASGTLIGGESTLTIEWNVEAGLPN
IFIILGSLDQDGATLQLFLSGEVVLNHTLASPATTGSYNWDIPYIAEDNLQILLQIAPDN
TRASSFVSGDTFSTEFPPFAVTSPRAYSFLIPGEDVTIKWQNFDGNDVKIQLVFRTSEGD
LAYPYSLFGDESTPNSGSATYTVPSIANDYPQPLLYTHNIYVKEVDGGTDDFFLGPLFVP
AVGYSFAGSVGTTGRAVQGTNITVAYTIVNFADEEVAVTISNATSGTIRLGALPNNFAFN
DSSHVATPFSASATIIIEPGEPLGTVTVRLYVERMPAISASRQITVLPPCEPGTFYNDTD
VTCNACPPDTFTDTINQDACQPHSTCPDGWVVAAAGTSTADTLCVDPAITLPIRMAAAAP
PGLLFAASPSDTTSVSDNTTVTSRSLLTVAARDSPVSIHSALGNKQATASITGTAITATA
PTATRVRAVLLGEPGLSHSRQPSQPAVVLPDETAVKVLLFALDGRGLAMQDAECHVRIQD
NAQQLTAVTAVCTTSSSSPTPSCTATLALPSSYFTAVHQLTLTAGPNATAAAEETADVAA
TLQTAQRVARPEPLTGDVLAVFPQRPLPRSKTFTLTVSAHGGARPLSSWQLRVTSPDANT
LQVQSVTGGSGWTVTASSLPSRDVAVLGVRAIEQGGGGGAGAEESVLFTADVLVGAMAAR
DVVLNVSVVEAFDSSGQPVLSGTAPLVVASSNPNPTAHRTSTVSLTTYNEADVVALHAFP
SMRTAGAPPTTAPLSNVLLNTAALNPDNAALQHPLTVSAYSASGSGTTLSPSTSLVCSSS
APEALQVDASCGYVHFTGAETAGSDSAQVVVQHATLPLNTTLRYKVWHPAAFRIAIDVQG
SSSGSDVVLRRIGGTALYQHVGYTIEADWSSATAMTSGGADDWLNSTDVTEEVWPLLQGQ
HVGGGSGDGNVIVTPLSITTNTSGTFRLCISHPLRTPSCLGARDIEATDSEPATPVAISA
TVVASVTAATTTSSADTYTRVSSSFTSVLTADQQSASVVVHAIFSDGSTRVLDPALHNTT
VTTGSPALIATNINAASSNSHPFVTTLGGGSVAVGLTWYVSDTTTVHGTVDVVSALPAVT
GVRVAGLPAAMAPSTDVSSQLPANLASSTLVSVFLQYDDGTEIDFTTDARTNIATEGNIT
ATVDGTRLRVAVADGSTEGQARLLVSFEHTGVTASLAVEVVVATGLRVALRPFPAFPGSE
DEEVAEVRRLGASNTWQQAMVDVSAVLSSGEVVSGNDHAELMVSTPAFFNYNSNTRLVSP
TPQLPGDEGMAVVVATLRDLFNTTAVTVSSLAWGVASITPVLPATTLAGTVNTKQQMRAS
VVMENGLTLTTTYLFPNGGALALPNLITFDITTPTATDAVVIDSATGTATLTGNSRTQET
LAVYAGDNADVNATALFYVNLVPTNYDVDLGATQQLPLAPVTGGDTVAISVRVRLPSTLA
FASISLQVTFDDAVLEFVDVAEGSDWPGGEFAGGLDGSGRISFGGSTAGVGPGTLTLFEV
TLRVKGGAGAGFSSVSGTAVTIADGDGTLLASDVPFVAGDVTLEITAPARRRRSHQSASA
TSTTVARAFGFSSTTASRARRAECGSPPCAVCMDQRQIGDADGNCLFDVRDVTFLKRFLN
ERLLDPDGAFVSAVQAFQMPDMDADGNTIINTVDVNFLLRANFGLFALVRSVNMTAPDTD
PSLAVSVEQTECSVAVYVQTISGGDGREQVPSDPQRTAVFVYLDSPNVTLHNNAQLVVTD
GEVVVADVATNQRGVFIKAAHDPARDAFFVAASSELPSDLVLTGVPLLISIDAAGETNAD
RATAALTYSDAPVSIAGEQRVAFTFLGQGFELVLNDYGPRVWVSTTTVSRNCREQLMCDD
EAGEYVAVNATTTDNPVCRALTTCVLGDSYETRAPTQFSDRVCANTTVCTPGQEYISVLP
TLVSDRRCSNISAPCTSTQFEAMAPTNTSDRVCTNTTVCDLSTQYIVTDATLSSNRVCAN
ISDACVFPLQFEIQAPTNTSDRACVTTLVCTASQYETVAPTPTSNRECTDLHTCNLDEYA
IVPPTPTTNRVCELATVCDDTEFESVELTPTSDRQCMLNPCNVSTICLPEGSCIPTATGP
YCDCPPGIDCGPTQPPTTDACAATVCSDEGMCVSTSSGAFCVCPDSAPNCGPTTAAPDLN
QSSDSSVDASLVAIATSCSFVGLLLVLGLVYASRFITCDRRKSKQPASVGGVQVFEQEGF
EMNLDDSISDGDGDNSRARLDRQVSVRTRESVETFKPLTLGRMDSFEETPFEAQATFEGG
PEDGGYSALPHQRLTANPAYEETGEQAKSNFYEDVGPAEGSGSGGGGGYQEVPRQRLTAN
PAYETVKQRPVSMENQYSDVGAGHYDVPHVKPAKETAEGYDLPRKTPRWSENQYEDISAA
PSRQTKEGDYDRPHQPSEGQYASVSGGAARNDGDYDRKPYMPNAVLYDELPGKSRRNSVV
ADVPEGSAPKRRRSTRVLKLSEDVLRDPERDVFFVKATAKNKQSYGGSKRVYKAMRFQGA
ANEAFVMPEDEDVDGDDADQQQRPAYFDPKATRDEKPAYFDPKATRDEKLAYFDPKATRD
EKPAYFDPVSAPPNPDYASPSAVTPGYEYGSLIQGPPGAEYASVPAHDEGEYMELSREDL
LANPMYASFADLEETTHADDANAESYLTIVPSKDE
Download sequence
Identical sequences F2UEI6
XP_004992680.1.12839 PTSG_07261T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]